PFRMAT RR TARGET T0288 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.3xnearNS_str2.miRvp_pplR.n28.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 SMVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAA GDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV 7 17 0 8 0.532372060211 7 19 0 8 0.56774802828 7 21 0 8 0.533214734666 7 54 0 8 0.514674265571 9 19 0 8 0.680350107934 9 20 0 8 0.568761136528 9 21 0 8 0.623882940141 9 31 0 8 0.526645402826 9 32 0 8 0.510552461538 9 33 0 8 0.55313421414 9 54 0 8 0.570754672113 9 55 0 8 0.511459197339 9 57 0 8 0.531485799146 9 74 0 8 0.519851122261 9 83 0 8 0.565672790416 9 85 0 8 0.520153701557 17 33 0 8 0.492685864632 17 54 0 8 0.492907745063 19 30 0 8 0.507244648815 19 31 0 8 0.577318088452 19 32 0 8 0.597825360251 19 33 0 8 0.606660099921 19 36 0 8 0.514525726644 19 48 0 8 0.50985847939 19 54 0 8 0.676962186803 19 55 0 8 0.569975777062 19 57 0 8 0.576250512019 19 70 0 8 0.551438780499 19 73 0 8 0.489219732496 19 74 0 8 0.55175357268 19 83 0 8 0.609830148311 19 85 0 8 0.497615013307 20 32 0 8 0.4998691889 20 33 0 8 0.588484066457 20 36 0 8 0.504681473872 20 54 0 8 0.560225971877 20 70 0 8 0.486976941113 20 74 0 8 0.500846842584 21 31 0 8 0.60241702828 21 32 0 8 0.606605631736 21 33 0 8 0.618599526159 21 36 0 8 0.517936620531 21 54 0 8 0.685491904635 21 55 0 8 0.5831788652 21 57 0 8 0.584720314847 21 70 0 8 0.525209526528 21 73 0 8 0.494113095512 21 74 0 8 0.54418887441 21 81 0 8 0.522607344579 21 83 0 8 0.617232374705 21 85 0 8 0.52107244233 22 33 0 8 0.507594172671 31 54 0 8 0.54720119344 31 57 0 8 0.491468520646 32 54 0 8 0.527179042676 33 54 0 8 0.677648485939 33 55 0 8 0.526557379758 33 57 0 8 0.553117873684 33 70 0 8 0.501059596235 33 74 0 8 0.523091471453 33 83 0 8 0.564321979419 33 85 0 8 0.491894291203 36 54 0 8 0.577579535742 36 57 0 8 0.491816333214 48 57 0 8 0.531325981577 53 62 0 8 0.51526842128 53 70 0 8 0.493135622262 53 74 0 8 0.497366800714 53 83 0 8 0.503166870497 54 67 0 8 0.495504345781 54 70 0 8 0.632897424823 54 71 0 8 0.507026829601 54 73 0 8 0.568837391987 54 74 0 8 0.661160966222 54 81 0 8 0.528466380046 54 83 0 8 0.623643280126 54 85 0 8 0.564398234878 55 67 0 8 0.545491629746 55 70 0 8 0.629863546897 55 71 0 8 0.544799086947 55 73 0 8 0.569812372506 55 74 0 8 0.63913403205 55 81 0 8 0.545046077735 55 83 0 8 0.644629871956 55 85 0 8 0.580760477769 56 70 0 8 0.557736775805 56 74 0 8 0.555007919717 56 83 0 8 0.494664798205 57 70 0 8 0.554038386017 57 74 0 8 0.552291140867 57 83 0 8 0.540004559874 74 83 0 8 0.564376447604 74 85 0 8 0.492853774147 END