PFRMAT RR TARGET T0287 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.3xnearNS_str2.miRvp_pplR.n28.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 MSNNMRKLFSMIADSKDKKEKLIESLQENELLNTDEKKKIIDQIKTMHDF FKQMHTNKGALDKVLRNYMKDYRAVIKSIGVDKFKKVYRLLESETMELLH AIAENPNFLFSKFDRSILGIFLPFFSKPIMFKMSIREMDSQIELYGTNLP LLKLFVMTDEEVNFYANLKTIEQYNDYVRDLLMKFDLEKYMKEKGVQNA 8 22 0 8 0.749815714561 8 31 0 8 0.7500945664 8 32 0 8 0.733886915584 8 40 0 8 0.736050748356 9 22 0 8 0.741245233936 9 31 0 8 0.744092561664 12 22 0 8 0.757462124329 12 23 0 8 0.751682064016 12 26 0 8 0.745357682281 12 31 0 8 0.7532330521 12 32 0 8 0.741758452516 12 40 0 8 0.742246002369 12 44 0 8 0.733085289616 22 31 0 8 0.760535735569 22 32 0 8 0.752616976225 22 40 0 8 0.744144319044 22 41 0 8 0.731546643025 22 50 0 8 0.732176282929 23 32 0 8 0.748676598121 23 40 0 8 0.745331782276 23 41 0 8 0.741599990244 23 44 0 8 0.737235173376 26 40 0 8 0.745349048896 26 41 0 8 0.739495083721 26 44 0 8 0.734973577636 26 50 0 8 0.7345861264 31 40 0 8 0.745445745664 32 44 0 8 0.730336032409 40 50 0 8 0.747408662784 40 64 0 8 0.743952825729 41 50 0 8 0.750586580496 41 54 0 8 0.737396603524 41 61 0 8 0.733143512644 41 64 0 8 0.746907320644 41 79 0 8 0.7377951025 44 54 0 8 0.746549568961 44 61 0 8 0.747163156996 44 64 0 8 0.756980042116 44 79 0 8 0.7364385856 44 87 0 8 0.730452262225 44 117 0 8 0.730493286721 51 61 0 8 0.755367836161 51 64 0 8 0.755920696969 51 65 0 8 0.735999273216 51 79 0 8 0.734709551104 61 75 0 8 0.743119857936 61 79 0 8 0.743500930225 61 87 0 8 0.737326190329 61 90 0 8 0.737054873361 64 75 0 8 0.735283955169 64 76 0 8 0.738272755984 64 79 0 8 0.754033459201 64 117 0 8 0.737662830129 64 154 0 8 0.733321620964 65 75 0 8 0.758977243249 65 76 0 8 0.763052913841 65 79 0 8 0.754733512516 65 84 0 8 0.734822699524 65 87 0 8 0.747642103569 65 90 0 8 0.745779052225 65 91 0 8 0.731774171844 65 98 0 8 0.739945760401 65 102 0 8 0.740260627456 65 109 0 8 0.730852300201 65 117 0 8 0.737054873361 65 118 0 8 0.729883166224 65 154 0 8 0.730746296569 69 79 0 8 0.749924824324 75 87 0 8 0.744494591281 75 90 0 8 0.74011609 75 109 0 8 0.730729199929 75 117 0 8 0.736242938116 76 87 0 8 0.763799089936 76 90 0 8 0.753443096121 76 91 0 8 0.743759632225 76 98 0 8 0.749026204369 76 99 0 8 0.736431720336 76 102 0 8 0.749845156096 76 109 0 8 0.734001714121 76 117 0 8 0.739245722436 76 118 0 8 0.731225083689 76 120 0 8 0.731904204196 76 154 0 8 0.733861215649 79 90 0 8 0.742564805284 84 98 0 8 0.738882933889 87 98 0 8 0.740382807025 87 102 0 8 0.7422167104 87 108 0 8 0.733032205929 87 109 0 8 0.738652583601 87 117 0 8 0.738391334209 87 120 0 8 0.731779304481 87 154 0 8 0.734673551161 88 98 0 8 0.7308882064 90 99 0 8 0.742068536356 90 102 0 8 0.747546993664 90 109 0 8 0.741057557409 90 117 0 8 0.7403225764 90 118 0 8 0.735433165476 90 120 0 8 0.732879815056 91 102 0 8 0.754660538944 91 108 0 8 0.731124183364 91 109 0 8 0.744401407369 91 117 0 8 0.744330660516 91 118 0 8 0.7435440441 91 120 0 8 0.737767616356 91 152 0 8 0.730250575209 91 154 0 8 0.735222217401 98 108 0 8 0.741656828025 98 109 0 8 0.752910231616 98 110 0 8 0.737561486596 98 113 0 8 0.734882706009 98 117 0 8 0.748263060484 98 118 0 8 0.746850282025 98 120 0 8 0.7417171129 98 122 0 8 0.732862693476 98 129 0 8 0.731450852001 98 152 0 8 0.729907087716 98 154 0 8 0.735853436761 99 108 0 8 0.7482769009 99 109 0 8 0.755176642081 99 110 0 8 0.7482769009 99 113 0 8 0.744287523841 99 117 0 8 0.7556998761 99 118 0 8 0.753609763449 99 120 0 8 0.750626433769 99 121 0 8 0.739670521681 99 122 0 8 0.741479432464 99 124 0 8 0.7302044304 99 129 0 8 0.740828589796 99 131 0 8 0.732831875136 99 135 0 8 0.7354434564 99 144 0 8 0.734673551161 99 151 0 8 0.735870593241 99 152 0 8 0.736998212196 99 154 0 8 0.740986969636 99 155 0 8 0.732792497089 102 113 0 8 0.740618590464 102 117 0 8 0.753498649849 102 118 0 8 0.750742534116 102 120 0 8 0.746497728001 102 121 0 8 0.732020558724 102 122 0 8 0.736939836304 102 129 0 8 0.737477325225 102 135 0 8 0.733679615601 102 151 0 8 0.733032205929 102 152 0 8 0.734598125569 102 154 0 8 0.737934258961 108 117 0 8 0.744092561664 108 118 0 8 0.736658290944 109 118 0 8 0.766917044644 109 120 0 8 0.765763256241 109 121 0 8 0.737850076324 109 122 0 8 0.732763392256 110 120 0 8 0.731286653409 118 129 0 8 0.750229680964 118 135 0 8 0.741341664144 118 142 0 8 0.730737748224 118 144 0 8 0.740799325809 118 151 0 8 0.739247442025 118 152 0 8 0.740375923401 118 154 0 8 0.74787904 118 155 0 8 0.732830163025 120 135 0 8 0.742980213369 142 154 0 8 0.740864740225 151 162 0 8 0.729890000896 152 162 0 8 0.744589506816 152 164 0 8 0.7372283044 152 168 0 8 0.736254950809 152 171 0 8 0.740539418116 152 178 0 8 0.738563203609 152 181 0 8 0.7536844225 152 182 0 8 0.731481641289 152 187 0 8 0.731597962225 154 164 0 8 0.734001714121 154 168 0 8 0.731035260036 154 171 0 8 0.762661623025 154 178 0 8 0.757552640625 154 181 0 8 0.755025442084 154 182 0 8 0.74511424 154 187 0 8 0.741610324224 155 164 0 8 0.767276139249 155 168 0 8 0.747754513984 155 171 0 8 0.754945503376 155 178 0 8 0.7637361664 155 181 0 8 0.768206672676 155 182 0 8 0.755346977449 155 187 0 8 0.748160991369 155 191 0 8 0.7410110724 156 171 0 8 0.749227005241 156 178 0 8 0.753035186176 156 181 0 8 0.751421987716 156 182 0 8 0.735292530064 171 181 0 8 0.757481271556 171 182 0 8 0.745454379609 171 187 0 8 0.736356204544 178 187 0 8 0.759095730121 178 196 0 8 0.736622243289 181 196 0 8 0.741694721089 182 196 0 8 0.744829411225 END