a2m2html output for tmp.a2m

Citations (SAM, SAM-T99, HMMs)

R. Hughey, A. Krogh, Hidden Markov models for sequence analysis: Extension and analysis of the basic method, CABIOS 12:95-107, 1996.
K. Karplus, C. Barrett, R. Hughey, Hidden Markov models for detecting remote protein homologies, Bioinformatics 14(10):846-856, 1998.
A. Krogh et al., Hidden Markov models in computational biology: Applications to protein modeling, JMB 235:1501-1531, Feb 1994.

Sequence numbers correspond to the following labels:

- T0285 AbfS, Cellvibrio japonicus, 125 res

              10        20        30        40        50        60     
              |         |         |         |         |         |     
   1 AYLPDDSPAKRLLFQMVGNAINRNTQQLTQDLRAMPNWSLRFVYIVDRNNQDLLKRPLPPGIMVL


         70        80        90       100       110       120     
         |         |         |         |         |         |     
   1 APRLTAKHPYDKVQDRNRKLYGRHITLNDGNSVKVVTISAGRDEGPDRDIIWEMFLENLE