PFRMAT RR TARGET T0285 AUTHOR 5370-1100-4902 REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.3xnearNS_str2.miRvp_pplR.n28.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz MODEL 1 AYLPDDSPAKRLLFQMVGNAINRNTQQLTQDLRAMPNWSLRFVYIVDRNN QDLLKRPLPPGIMVLAPRLTAKHPYDKVQDRNRKLYGRHITLNDGNSVKV VTISAGRDEGPDRDIIWEMFLENLE 3 12 0 8 0.421441538598 3 13 0 8 0.415861111922 12 21 0 8 0.441517279045 12 28 0 8 0.419948 12 32 0 8 0.409224255696 12 42 0 8 0.404408689046 12 43 0 8 0.409148567089 12 45 0 8 0.405061382278 13 28 0 8 0.437522160743 13 32 0 8 0.424174747201 13 42 0 8 0.419477716545 13 43 0 8 0.421972354744 13 45 0 8 0.418112645985 13 46 0 8 0.406813032911 14 28 0 8 0.417783863747 17 28 0 8 0.433717497082 17 32 0 8 0.420749169711 17 42 0 8 0.414204715328 17 43 0 8 0.421382192693 17 45 0 8 0.418483046229 21 32 0 8 0.433155643061 21 40 0 8 0.411262441772 21 42 0 8 0.41952349635 21 43 0 8 0.436437012202 21 45 0 8 0.433509325729 21 46 0 8 0.41121378481 28 40 0 8 0.417546641119 28 42 0 8 0.42627051799 28 43 0 8 0.435998523607 28 45 0 8 0.432182697316 32 42 0 8 0.444317650996 32 43 0 8 0.453790782403 32 44 0 8 0.421547042428 32 45 0 8 0.450751842006 32 46 0 8 0.423396656453 32 53 0 8 0.418329059611 42 53 0 8 0.426125890919 42 54 0 8 0.414084023114 42 100 0 8 0.417646524331 42 101 0 8 0.404612656962 43 53 0 8 0.572345143126 43 54 0 8 0.537210173894 43 58 0 8 0.443590398569 43 62 0 8 0.530622945213 43 63 0 8 0.472380209612 43 64 0 8 0.469986205977 43 65 0 8 0.453166714286 43 69 0 8 0.446210208482 43 78 0 8 0.437105818037 43 85 0 8 0.444338915687 43 90 0 8 0.466429364676 43 92 0 8 0.462008836086 43 98 0 8 0.464582592122 43 100 0 8 0.532139598293 43 101 0 8 0.521958174452 43 103 0 8 0.526458353806 43 115 0 8 0.488050362657 43 116 0 8 0.462647878018 43 119 0 8 0.426099595089 43 120 0 8 0.423990115498 43 121 0 8 0.43341188382 44 53 0 8 0.501773840636 44 54 0 8 0.440994636074 44 62 0 8 0.408256522785 45 54 0 8 0.520681839965 45 62 0 8 0.50466121162 45 63 0 8 0.429272625357 45 64 0 8 0.467367407878 45 65 0 8 0.429662680183 45 69 0 8 0.428948310109 45 78 0 8 0.432077513992 45 85 0 8 0.404910005063 45 90 0 8 0.469909561793 45 92 0 8 0.439280544297 45 98 0 8 0.462577524778 45 100 0 8 0.514718277105 45 101 0 8 0.506545601104 45 103 0 8 0.540256393619 45 115 0 8 0.497670734502 45 116 0 8 0.461029972564 45 119 0 8 0.405818268354 45 121 0 8 0.420742575722 46 62 0 8 0.413721946472 46 100 0 8 0.409132348101 46 101 0 8 0.404213440989 46 103 0 8 0.406980629114 54 63 0 8 0.420970068356 54 65 0 8 0.422806494402 62 78 0 8 0.410716402532 62 90 0 8 0.426634276985 62 98 0 8 0.401874901767 62 100 0 8 0.462196444727 62 101 0 8 0.488937884381 62 103 0 8 0.448787489014 64 100 0 8 0.440024646154 64 101 0 8 0.440600439257 64 103 0 8 0.432265967447 65 101 0 8 0.402806767491 78 100 0 8 0.403348137102 90 100 0 8 0.49755422655 90 101 0 8 0.501231825381 90 103 0 8 0.488434155835 90 115 0 8 0.418021086375 90 116 0 8 0.420722793754 92 101 0 8 0.408353836709 92 103 0 8 0.407083349367 98 115 0 8 0.431989861222 98 116 0 8 0.429049110794 100 115 0 8 0.498293798767 100 116 0 8 0.461636550191 100 117 0 8 0.421375598704 100 119 0 8 0.435630901857 100 120 0 8 0.435378438727 100 121 0 8 0.443845574859 101 115 0 8 0.560977632836 101 116 0 8 0.550576734217 101 117 0 8 0.444326156873 101 119 0 8 0.493177599641 101 120 0 8 0.491582459246 101 121 0 8 0.462606838628 103 115 0 8 0.492290077917 103 116 0 8 0.483156999641 103 119 0 8 0.422209738362 103 120 0 8 0.415253489051 103 121 0 8 0.423871423689 END