PFRMAT RR
TARGET T0281
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The predictions are limited to a score >= .18 which
REMARK is an approximation of the probability.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 280 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD NN: /projects/compbio/experiments/protein-predict/casp6/networks/NN280-240n300.net.28
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
MWMPPRPEEVARKLRRLGFVERMAKGGHRLYTHPDGRIVVVPFHSGELPK
GTFKRILRDAGLTEEEFHNL
7 43 0 8 0.4947
17 37 0 8 0.43945
7 44 0 8 0.391
17 64 0 8 0.3859
4 24 0 8 0.3808
41 62 0 8 0.3757
4 21 0 8 0.3281
29 43 0 8 0.31875
3 24 0 8 0.3162
11 39 0 8 0.3026
4 27 0 8 0.29325
10 41 0 8 0.2839
4 23 0 8 0.27455
17 65 0 8 0.255
2 23 0 8 0.255
38 60 0 8 0.24055
38 56 0 8 0.21845
19 39 0 8 0.2125
39 55 0 8 0.20485
3 21 0 8 0.20315
9 21 0 8 0.1972
3 20 0 8 0.1955
44 67 0 8 0.1921
2 40 0 8 0.1887
17 38 0 8 0.187
41 51 0 8 0.1853
END