PFRMAT RR TARGET T0276 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: /projects/compbio/experiments/protein-predict/casp6/networks/NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MTKAELRRRARAAWRRLDLKALSRAVGAALLPWLRERGFRHILLYHPLPH ELNLLPLMEAYPARYYLPKVAGKGLTVHPFGPLAPGPFGLLEPTTPPEDP RVLDLVVVPGLAFDREGYRLGHGQGFYDRFLKEVRAATVGVVPQALLFPA LPRDPWDVPVDHLATEAGVEAVKRPAPGPGGLLD 140 160 0 8 0.7276 44 58 0 8 0.6766 75 113 0 8 0.6749 109 127 0 8 0.6664 110 160 0 8 0.6613 110 140 0 8 0.63155 111 139 0 8 0.62815 45 140 0 8 0.6222 113 140 0 8 0.6052 75 140 0 8 0.6035 46 141 0 8 0.5882 75 110 0 8 0.5865 44 103 0 8 0.57715 75 130 0 8 0.57035 109 140 0 8 0.56865 110 130 0 8 0.55675 45 109 0 8 0.55675 75 109 0 8 0.55505 46 109 0 8 0.54995 110 141 0 8 0.5338 10 112 0 8 0.5338 75 160 0 8 0.53125 46 140 0 8 0.52615 11 122 0 8 0.5168 45 127 0 8 0.50405 42 142 0 8 0.50405 54 110 0 8 0.4998 10 111 0 8 0.4947 110 145 0 8 0.4896 70 109 0 8 0.4896 54 65 0 8 0.4896 110 146 0 8 0.48705 110 131 0 8 0.48705 54 75 0 8 0.48195 109 131 0 8 0.47175 46 65 0 8 0.4641 11 110 0 8 0.46155 39 63 0 8 0.45645 47 109 0 8 0.4437 109 130 0 8 0.44115 44 110 0 8 0.44115 75 141 0 8 0.42925 70 141 0 8 0.4233 46 110 0 8 0.4233 75 127 0 8 0.42075 77 134 0 8 0.4131 43 77 0 8 0.4131 46 103 0 8 0.41055 107 140 0 8 0.40885 11 47 0 8 0.40885 11 22 0 8 0.40885 70 113 0 8 0.4012 47 110 0 8 0.39865 70 110 0 8 0.3961 45 110 0 8 0.39355 110 127 0 8 0.391 54 140 0 8 0.391 142 160 0 8 0.38845 113 146 0 8 0.38845 109 142 0 8 0.38845 77 110 0 8 0.38335 103 142 0 8 0.3808 58 109 0 8 0.3808 140 165 0 8 0.37825 46 70 0 8 0.37825 44 54 0 8 0.3757 67 110 0 8 0.37315 46 75 0 8 0.37315 113 142 0 8 0.3706 66 110 0 8 0.36295 66 77 0 8 0.36295 54 141 0 8 0.36295 36 63 0 8 0.36295 122 140 0 8 0.3604 75 156 0 8 0.3553 127 140 0 8 0.34085 70 140 0 8 0.33575 70 127 0 8 0.3332 70 90 0 8 0.3332 43 110 0 8 0.33065 14 140 0 8 0.33065 113 147 0 8 0.3281 110 142 0 8 0.32385 110 134 0 8 0.32385 69 110 0 8 0.32385 58 110 0 8 0.32385 70 134 0 8 0.3213 58 134 0 8 0.3213 14 75 0 8 0.3213 77 146 0 8 0.31875 47 140 0 8 0.31875 34 58 0 8 0.31875 75 107 0 8 0.3162 58 113 0 8 0.3145 65 130 0 8 0.31195 39 105 0 8 0.31195 45 70 0 8 0.3094 110 122 0 8 0.30685 47 122 0 8 0.30685 44 57 0 8 0.30685 18 122 0 8 0.3043 110 138 0 8 0.2975 47 75 0 8 0.2975 43 109 0 8 0.2975 51 109 0 8 0.29495 47 103 0 8 0.29495 108 169 0 8 0.29325 67 120 0 8 0.29325 46 67 0 8 0.29325 52 110 0 8 0.28815 46 66 0 8 0.28645 11 48 0 8 0.28645 146 163 0 8 0.2839 66 122 0 8 0.27965 66 103 0 8 0.27965 47 70 0 8 0.2771 19 122 0 8 0.2771 110 147 0 8 0.27455 52 103 0 8 0.27455 69 78 0 8 0.2703 37 63 0 8 0.2686 46 134 0 8 0.2635 19 143 0 8 0.2618 120 140 0 8 0.25925 61 140 0 8 0.25925 105 160 0 8 0.25755 77 124 0 8 0.25755 122 143 0 8 0.255 46 122 0 8 0.2533 45 113 0 8 0.2533 61 139 0 8 0.25075 43 66 0 8 0.25075 34 63 0 8 0.25075 111 122 0 8 0.24905 77 130 0 8 0.24905 70 142 0 8 0.24905 109 143 0 8 0.2465 54 92 0 8 0.2465 78 122 0 8 0.2448 46 58 0 8 0.2448 14 110 0 8 0.24225 131 140 0 8 0.24055 48 109 0 8 0.24055 47 141 0 8 0.24055 44 130 0 8 0.24055 51 70 0 8 0.238 46 80 0 8 0.238 19 130 0 8 0.238 46 130 0 8 0.23205 148 165 0 8 0.23035 57 75 0 8 0.23035 48 75 0 8 0.23035 11 58 0 8 0.23035 109 129 0 8 0.2278 71 167 0 8 0.2278 61 75 0 8 0.2278 43 142 0 8 0.2278 122 138 0 8 0.2261 57 110 0 8 0.2261 14 122 0 8 0.2261 144 167 0 8 0.2244 110 124 0 8 0.2244 26 109 0 8 0.2244 78 166 0 8 0.22185 70 122 0 8 0.22185 69 138 0 8 0.22185 67 80 0 8 0.22185 66 113 0 8 0.22015 58 70 0 8 0.21845 48 58 0 8 0.21845 45 75 0 8 0.21845 70 130 0 8 0.21675 48 122 0 8 0.21675 19 47 0 8 0.21675 105 172 0 8 0.2142 51 127 0 8 0.2142 54 130 0 8 0.2125 43 140 0 8 0.2125 130 140 0 8 0.2108 47 80 0 8 0.2108 26 143 0 8 0.2108 10 164 0 8 0.2108 113 130 0 8 0.2091 92 110 0 8 0.2091 61 70 0 8 0.2091 43 75 0 8 0.2091 11 109 0 8 0.2091 61 110 0 8 0.20485 14 160 0 8 0.20485 14 46 0 8 0.20485 51 110 0 8 0.20315 48 70 0 8 0.20315 43 70 0 8 0.20315 110 143 0 8 0.20145 103 130 0 8 0.20145 93 109 0 8 0.20145 58 130 0 8 0.20145 47 143 0 8 0.20145 47 130 0 8 0.20145 114 151 0 8 0.1972 45 122 0 8 0.1972 122 141 0 8 0.1955 112 142 0 8 0.1955 90 109 0 8 0.1955 75 143 0 8 0.1955 67 162 0 8 0.1955 51 75 0 8 0.1955 17 140 0 8 0.1955 140 161 0 8 0.1938 50 140 0 8 0.1938 50 122 0 8 0.1938 48 171 0 8 0.1938 47 58 0 8 0.1938 43 127 0 8 0.1938 17 113 0 8 0.1921 11 124 0 8 0.1921 110 136 0 8 0.1904 93 127 0 8 0.1904 54 156 0 8 0.1904 51 122 0 8 0.1904 14 164 0 8 0.1904 27 39 0 8 0.1887 57 134 0 8 0.187 47 72 0 8 0.187 44 90 0 8 0.187 78 130 0 8 0.1853 66 142 0 8 0.1853 43 59 0 8 0.1853 115 150 0 8 0.1836 41 66 0 8 0.1836 86 122 0 8 0.1819 69 122 0 8 0.1819 63 110 0 8 0.1819 57 141 0 8 0.1819 22 130 0 8 0.1819 63 117 0 8 0.1802 43 124 0 8 0.1802 END