CASP6 Target T0274
- 1. Protein Name
- 1wgb
- 2. Organism Name
- Thermus thermophilus
- 3. Number of amino acids (approx)
- 159
- 4. Accession number
- 5. Sequence Database
-
6. Amino acid sequence
-
MNLEAKKKVLRSFTYGLYVLTAKDGDEVAAGTVNWVTQASFQPPLVAVGLKRDSHLHALV
ERTGKLALMTLAHDQKAIAQDFFKPTVREGDRLNGHPFEPSPTFGLPLLTELPYWLEAEV
RHLYPGGDHSLVVAEVVEAGVRREEKPLVMWDTGWFYGG
-
7. Additional information
-
-
8. X-ray structure
- yes
- 9. Current state of the experimental work
- Completed, deposited to PDB
- 10. Interpretable map?
- no
- 11. Estimated date of chain tracing completion
- Completed
- 12. Estimated date of public release of structure
- After Sep. 1
Related Files
Template Sequence file
Template PDB file