PFRMAT RR TARGET T0272 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEP ARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLR ANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQ DTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGK ALGLGLLSVAP 29 95 0 8 0.43945 59 99 0 8 0.30685 182 206 0 8 0.27965 99 192 0 8 0.255 33 63 0 8 0.2533 77 171 0 8 0.25075 76 171 0 8 0.238 61 176 0 8 0.2363 44 209 0 8 0.2363 104 202 0 8 0.2108 82 137 0 8 0.19975 59 77 0 8 0.1972 51 168 0 8 0.1955 58 168 0 8 0.187 36 168 0 8 0.187 156 206 0 8 0.1836 69 114 0 8 0.1836 66 76 0 8 0.1836 END