PFRMAT RR
TARGET T0270
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The predictions are limited to a score >= .18 which
REMARK is an approximation of the probability.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 280 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD NN: /projects/compbio/experiments/protein-predict/casp6/networks/NN280-240n300.net.28
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
MERHVPEPTHTLEGWHVLHDFRLLDFARWFSAPLEAREDAWEELKGLVRE
WRELEEAGQGSYGIYQVVGHKADLLFLNLRPGLDPLLEAEARLSRSAFAR
YLGRSYSFYSVVELGSQEKPLDPESPYVKPRLTPRVPKSGYVCFYPMNKR
RQGQDNWYMLPAKERASLMKAHGETGRKYQGEVMQVISGAQGLDDWEWGV
DLFSEDPVQFKKIVYEMRFDEVSARYGEFGPFFVGKYLDEEALRAFLGL
18 144 0 8 0.5525
187 201 0 8 0.5406
143 226 0 8 0.5236
202 213 0 8 0.5168
79 226 0 8 0.5117
144 187 0 8 0.47685
67 108 0 8 0.4743
144 176 0 8 0.4641
22 179 0 8 0.459
18 186 0 8 0.459
28 108 0 8 0.43945
27 108 0 8 0.4182
201 226 0 8 0.40375
75 186 0 8 0.40375
66 122 0 8 0.40375
74 186 0 8 0.38335
202 226 0 8 0.3757
185 215 0 8 0.36805
74 144 0 8 0.3604
108 201 0 8 0.35785
79 225 0 8 0.35275
66 108 0 8 0.35275
18 202 0 8 0.35275
144 202 0 8 0.34595
90 108 0 8 0.34595
198 232 0 8 0.34085
145 197 0 8 0.3383
144 230 0 8 0.3383
144 226 0 8 0.3332
147 200 0 8 0.33065
27 90 0 8 0.32385
185 224 0 8 0.31875
215 224 0 8 0.3162
215 225 0 8 0.30685
186 202 0 8 0.3043
185 223 0 8 0.3043
187 226 0 8 0.2975
187 222 0 8 0.2975
127 211 0 8 0.2975
147 234 0 8 0.29495
71 225 0 8 0.29325
28 121 0 8 0.28645
18 168 0 8 0.2839
185 229 0 8 0.28135
144 213 0 8 0.27965
19 189 0 8 0.27965
18 226 0 8 0.27965
215 229 0 8 0.2771
186 226 0 8 0.27455
90 121 0 8 0.27455
44 79 0 8 0.2703
25 83 0 8 0.2703
18 75 0 8 0.2703
211 229 0 8 0.2686
21 83 0 8 0.2686
80 225 0 8 0.26605
70 209 0 8 0.26605
144 186 0 8 0.2618
144 200 0 8 0.25925
71 229 0 8 0.25925
18 74 0 8 0.25925
188 215 0 8 0.25755
185 225 0 8 0.25755
19 201 0 8 0.25755
220 229 0 8 0.255
211 220 0 8 0.255
186 225 0 8 0.255
159 185 0 8 0.255
71 185 0 8 0.255
21 102 0 8 0.2533
19 226 0 8 0.25075
185 230 0 8 0.24905
185 226 0 8 0.24905
185 201 0 8 0.24905
147 226 0 8 0.24905
188 200 0 8 0.2465
187 203 0 8 0.2465
19 185 0 8 0.2465
211 225 0 8 0.24225
213 226 0 8 0.238
185 227 0 8 0.238
66 121 0 8 0.2363
219 230 0 8 0.2346
215 226 0 8 0.23205
202 225 0 8 0.23205
173 198 0 8 0.23035
28 122 0 8 0.2261
185 209 0 8 0.2244
144 196 0 8 0.2244
203 226 0 8 0.22185
111 168 0 8 0.22185
211 226 0 8 0.22015
144 201 0 8 0.22015
19 60 0 8 0.22015
211 224 0 8 0.21845
108 121 0 8 0.21675
62 204 0 8 0.21675
18 196 0 8 0.21675
203 217 0 8 0.2142
201 225 0 8 0.2142
19 219 0 8 0.2142
80 227 0 8 0.2125
27 68 0 8 0.2125
188 223 0 8 0.2108
147 201 0 8 0.2108
79 201 0 8 0.2108
67 90 0 8 0.2108
215 230 0 8 0.20655
194 229 0 8 0.20655
74 196 0 8 0.20655
18 98 0 8 0.20655
144 225 0 8 0.20485
67 112 0 8 0.20485
185 211 0 8 0.20315
158 197 0 8 0.20315
71 186 0 8 0.20315
189 226 0 8 0.20145
119 185 0 8 0.19975
109 196 0 8 0.19975
211 230 0 8 0.1972
80 211 0 8 0.1972
215 227 0 8 0.1955
186 215 0 8 0.1938
220 230 0 8 0.1904
199 213 0 8 0.1904
22 173 0 8 0.1904
90 159 0 8 0.1887
79 202 0 8 0.1887
71 230 0 8 0.1887
67 121 0 8 0.1887
147 186 0 8 0.187
67 179 0 8 0.187
19 211 0 8 0.187
15 30 0 8 0.187
148 185 0 8 0.1853
119 211 0 8 0.1853
211 227 0 8 0.1836
189 230 0 8 0.1836
189 209 0 8 0.1836
129 211 0 8 0.1836
27 121 0 8 0.1836
159 187 0 8 0.1819
28 90 0 8 0.1819
19 220 0 8 0.1819
134 226 0 8 0.1802
122 209 0 8 0.1802
111 128 0 8 0.1802
103 168 0 8 0.1802
END