PFRMAT RR TARGET T0270 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MERHVPEPTHTLEGWHVLHDFRLLDFARWFSAPLEAREDAWEELKGLVRE WRELEEAGQGSYGIYQVVGHKADLLFLNLRPGLDPLLEAEARLSRSAFAR YLGRSYSFYSVVELGSQEKPLDPESPYVKPRLTPRVPKSGYVCFYPMNKR RQGQDNWYMLPAKERASLMKAHGETGRKYQGEVMQVISGAQGLDDWEWGV DLFSEDPVQFKKIVYEMRFDEVSARYGEFGPFFVGKYLDEEALRAFLGL 187 201 0 8 0.54995 18 144 0 8 0.54995 202 213 0 8 0.51935 143 226 0 8 0.51935 79 226 0 8 0.50915 67 108 0 8 0.4896 144 187 0 8 0.46665 22 179 0 8 0.4641 144 176 0 8 0.46155 201 226 0 8 0.4063 66 122 0 8 0.4063 75 186 0 8 0.4012 202 226 0 8 0.391 18 186 0 8 0.3757 74 186 0 8 0.37315 28 108 0 8 0.3655 108 201 0 8 0.36295 185 215 0 8 0.3604 74 144 0 8 0.3604 199 214 0 8 0.35785 66 108 0 8 0.35785 187 226 0 8 0.3553 145 197 0 8 0.3553 90 108 0 8 0.35275 18 202 0 8 0.35275 144 202 0 8 0.3434 144 230 0 8 0.34085 215 224 0 8 0.33575 144 226 0 8 0.33575 220 229 0 8 0.33065 198 232 0 8 0.33065 27 108 0 8 0.33065 219 230 0 8 0.3281 147 200 0 8 0.3281 127 211 0 8 0.3145 186 202 0 8 0.3094 185 223 0 8 0.3043 187 222 0 8 0.30005 185 224 0 8 0.30005 71 225 0 8 0.2975 147 234 0 8 0.29495 44 79 0 8 0.28815 28 121 0 8 0.28645 220 230 0 8 0.2839 215 229 0 8 0.28135 18 168 0 8 0.28135 215 225 0 8 0.27965 185 229 0 8 0.27965 144 213 0 8 0.27965 90 121 0 8 0.27965 186 226 0 8 0.2771 19 189 0 8 0.27455 18 226 0 8 0.27455 211 229 0 8 0.2703 188 215 0 8 0.2703 25 83 0 8 0.2703 18 75 0 8 0.2703 201 210 0 8 0.26605 18 74 0 8 0.2635 211 220 0 8 0.2618 185 225 0 8 0.2618 159 185 0 8 0.2618 144 186 0 8 0.2618 21 83 0 8 0.2618 144 200 0 8 0.25755 71 229 0 8 0.25755 71 185 0 8 0.25755 19 201 0 8 0.25755 202 225 0 8 0.255 186 225 0 8 0.255 70 209 0 8 0.255 188 200 0 8 0.2533 185 227 0 8 0.2533 185 226 0 8 0.25075 79 225 0 8 0.25075 21 102 0 8 0.25075 19 226 0 8 0.25075 187 203 0 8 0.24905 185 230 0 8 0.24905 211 225 0 8 0.24225 147 226 0 8 0.24225 185 201 0 8 0.24055 66 121 0 8 0.24055 144 196 0 8 0.23205 215 226 0 8 0.23035 213 226 0 8 0.2261 144 201 0 8 0.2244 111 168 0 8 0.2244 201 225 0 8 0.22185 185 209 0 8 0.22185 173 198 0 8 0.22185 108 121 0 8 0.22185 19 60 0 8 0.22185 185 211 0 8 0.22015 211 226 0 8 0.21845 211 224 0 8 0.21845 203 226 0 8 0.21675 179 198 0 8 0.21675 28 122 0 8 0.21675 203 217 0 8 0.2142 79 201 0 8 0.2142 147 201 0 8 0.2125 18 196 0 8 0.2125 188 223 0 8 0.2108 144 225 0 8 0.2108 27 90 0 8 0.2108 27 68 0 8 0.2108 28 90 0 8 0.2091 215 230 0 8 0.20655 74 196 0 8 0.20655 194 229 0 8 0.20485 189 226 0 8 0.20485 158 197 0 8 0.20485 71 186 0 8 0.20485 67 90 0 8 0.20485 18 98 0 8 0.20485 119 185 0 8 0.20315 67 201 0 8 0.20145 67 112 0 8 0.20145 215 227 0 8 0.1972 211 230 0 8 0.1972 80 211 0 8 0.1938 109 196 0 8 0.1921 22 173 0 8 0.1921 19 219 0 8 0.1921 186 215 0 8 0.1904 44 78 0 8 0.1904 134 219 0 8 0.1887 90 159 0 8 0.1887 79 202 0 8 0.1887 67 121 0 8 0.1887 19 211 0 8 0.1887 176 223 0 8 0.187 142 226 0 8 0.187 119 211 0 8 0.187 67 179 0 8 0.187 62 71 0 8 0.187 203 225 0 8 0.1853 200 215 0 8 0.1853 179 232 0 8 0.1853 71 230 0 8 0.1853 15 30 0 8 0.1853 211 227 0 8 0.1836 159 187 0 8 0.1836 129 211 0 8 0.1836 111 128 0 8 0.1836 189 230 0 8 0.1819 186 213 0 8 0.1802 27 121 0 8 0.1802 END