PFRMAT RR TARGET T0268 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MRPMTHVPVLYQEALDLLAVRPGGVYVDATLGGAGHARGILERGGRVIGL DQDPEAVARAKGLHLPGLTVVQGNFRHLKRHLAALGVERVDGILADLGVS SFHLDDPSRGFSYQKEGPLDMRMGLEGPTAKEVVNRLPLEALARLLRELG EEPQAYRIARAIVAAREKAPIETTTQLAEIVRKAVGFRRAGHPARKTFQA LRIYVNDELNALKEFLEQAAEVLAPGGRLVVIAFHSLEDRVVKRFLRESG LKVLTKKPLVPSEKEAAQNPRARSAKLRAAEKEAP 29 95 0 8 0.5797 27 90 0 8 0.54315 33 102 0 8 0.53125 94 232 0 8 0.50915 146 197 0 8 0.45645 37 47 0 8 0.45645 96 177 0 8 0.45135 252 281 0 8 0.4318 113 195 0 8 0.42925 31 60 0 8 0.4233 51 159 0 8 0.4131 137 204 0 8 0.40375 171 180 0 8 0.4012 33 101 0 8 0.39355 96 121 0 8 0.391 95 215 0 8 0.391 129 150 0 8 0.38845 96 134 0 8 0.38845 37 134 0 8 0.35785 31 96 0 8 0.3502 33 137 0 8 0.34765 31 137 0 8 0.34765 27 37 0 8 0.34765 251 280 0 8 0.3434 26 92 0 8 0.34085 60 96 0 8 0.3383 40 94 0 8 0.3332 99 177 0 8 0.3281 239 278 0 8 0.3264 134 162 0 8 0.32385 134 177 0 8 0.31195 121 134 0 8 0.31195 52 211 0 8 0.31195 31 134 0 8 0.31195 31 133 0 8 0.31195 26 97 0 8 0.3094 97 177 0 8 0.30685 92 134 0 8 0.30685 74 211 0 8 0.3043 133 204 0 8 0.30005 121 137 0 8 0.2907 60 137 0 8 0.2907 53 111 0 8 0.2839 111 130 0 8 0.28135 144 156 0 8 0.27965 99 121 0 8 0.2771 60 104 0 8 0.27455 158 177 0 8 0.27285 33 232 0 8 0.27285 36 232 0 8 0.2686 123 177 0 8 0.2635 256 276 0 8 0.25925 33 99 0 8 0.25925 56 104 0 8 0.25755 68 93 0 8 0.255 95 113 0 8 0.24905 133 197 0 8 0.2448 97 174 0 8 0.24055 99 137 0 8 0.238 205 230 0 8 0.2363 53 110 0 8 0.2346 53 75 0 8 0.2346 137 181 0 8 0.23205 134 174 0 8 0.23035 99 123 0 8 0.23035 52 74 0 8 0.23035 33 52 0 8 0.23035 33 50 0 8 0.23035 147 156 0 8 0.2278 134 202 0 8 0.2261 111 129 0 8 0.2261 36 94 0 8 0.2261 53 96 0 8 0.2244 36 51 0 8 0.21845 104 166 0 8 0.2142 60 166 0 8 0.2142 53 134 0 8 0.2142 123 158 0 8 0.2091 78 198 0 8 0.2091 49 149 0 8 0.2091 60 159 0 8 0.20655 53 99 0 8 0.20315 204 246 0 8 0.20145 96 111 0 8 0.20145 75 134 0 8 0.20145 104 159 0 8 0.19975 96 112 0 8 0.19975 24 45 0 8 0.19975 105 123 0 8 0.1972 53 121 0 8 0.1955 37 87 0 8 0.1955 24 74 0 8 0.1955 97 242 0 8 0.1938 60 111 0 8 0.1938 36 60 0 8 0.1938 152 196 0 8 0.1904 112 129 0 8 0.1904 26 45 0 8 0.1904 174 185 0 8 0.187 31 111 0 8 0.187 131 150 0 8 0.1853 111 134 0 8 0.1853 33 111 0 8 0.1853 117 174 0 8 0.1836 20 45 0 8 0.1836 247 257 0 8 0.1819 204 232 0 8 0.1819 118 178 0 8 0.1819 123 211 0 8 0.1802 76 211 0 8 0.1802 53 177 0 8 0.1802 31 113 0 8 0.1802 END