CASP6 Target T0267
- 1. Protein Name
- 1wk4
- 2. Organism Name
- Thermus thermophilus
- 3. Number of amino acids (approx)
- 175
- 4. Accession number
- AAS81192 (99%)
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
- MVRIRRAGLEDLPGVARVLVDTWRATYRGVVPEAFLEGLSYEGQAERWAQRLKTPTWPGR
LFVAESESGEVVGFAAFGPDRASGFPGYTAELWAIYVLPTWQRKGLGRALFHEGARLLQA
EGYGRMLVWVLKENPKGRGFYEHLGGVLLGEREIELGGAKLWEVAYGFDLGGHKW
-
7. Additional information
-
-
8. X-ray structure
- yes
- 9. Current state of the experimental work
- -
- 10. Interpretable map?
- no
- 11. Estimated date of chain tracing completion
- 09/01/2004
- 12. Estimated date of public release of structure
- 10/2004
Related Files
Template Sequence file
Template PDB file