PFRMAT RR TARGET T0265 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MMKEKLESKKDEIRCCYKITDTDVAVLLKMVEIEKPITSEELADIFKLSK TTVENSLKKLIELGLVVRTKTEGKKIGRPKYYYSISSNILEKIRNDLLNC AKRMELAAT 15 100 0 8 0.5474 50 73 0 8 0.48705 37 46 0 8 0.35785 13 46 0 8 0.3553 89 104 0 8 0.3264 33 54 0 8 0.31875 78 100 0 8 0.30005 45 63 0 8 0.29495 23 68 0 8 0.28135 16 46 0 8 0.27965 13 42 0 8 0.2703 23 56 0 8 0.2635 6 97 0 8 0.25755 15 54 0 8 0.255 25 66 0 8 0.2261 53 66 0 8 0.22015 13 37 0 8 0.20655 15 56 0 8 0.1938 57 83 0 8 0.1836 24 83 0 8 0.1836 END