PFRMAT RR TARGET T0262 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MPSSSQYRRYQDPHHPSIPTPTTLFSQPSLEILGGGVAEELPELALCCDG TVVEGRSNCRCKARAVLPGGMRVRLSKTLAGILRHHPGRYGVRLTREGWA RVSEVVEGLRKAGWSWVEEWHIVGVALHDPKGRYELRNGEIRARYGHSIP VNVEPLPGEPPPILYHGTTEEALPLIMERGIMRGRRLKVHLTSSLEDAVS TGRRHGNLVAVLLVDVECLRRRGLKVERMSKTVYTVDWVPPECIAEVRRE SLGRSL 82 213 0 8 0.3332 166 186 0 8 0.3213 145 231 0 8 0.31875 191 214 0 8 0.3043 145 188 0 8 0.3026 145 229 0 8 0.2975 78 101 0 8 0.28815 102 136 0 8 0.28645 156 228 0 8 0.2703 175 228 0 8 0.24905 172 200 0 8 0.24225 126 210 0 8 0.238 188 229 0 8 0.23205 78 209 0 8 0.2261 114 153 0 8 0.22185 73 228 0 8 0.21675 169 216 0 8 0.20485 165 214 0 8 0.20315 110 228 0 8 0.20315 67 145 0 8 0.20145 156 175 0 8 0.1955 118 231 0 8 0.1853 182 238 0 8 0.1819 END