PFRMAT RR
TARGET T0262
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The predictions are limited to a score >= .18 which
REMARK is an approximation of the probability.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 280 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD NN: /projects/compbio/experiments/protein-predict/casp6/networks/NN280-240n300.net.28
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
LSKTLAGILRHHPGRYGVRLTREGWARVSEVVEGLRKAGWSWVEEWHIVG
VALHDPKGRYELRNGEIRARYGHSIPVNVEPLPGEPPPILYHGTTEEALP
LIMERGIMRGRRLKVHLTSSLEDAVS
164 189 0 8 0.4318
87 99 0 8 0.36805
87 111 0 8 0.36295
81 100 0 8 0.36295
78 87 0 8 0.34765
99 198 0 8 0.2907
88 112 0 8 0.28135
160 184 0 8 0.2703
79 134 0 8 0.2703
106 136 0 8 0.2686
145 188 0 8 0.26605
122 173 0 8 0.26605
145 165 0 8 0.2618
125 164 0 8 0.25925
166 186 0 8 0.2533
135 144 0 8 0.2533
82 106 0 8 0.24905
145 191 0 8 0.2465
134 181 0 8 0.24225
134 145 0 8 0.24225
78 90 0 8 0.24225
99 165 0 8 0.24055
144 188 0 8 0.23035
102 167 0 8 0.2244
114 172 0 8 0.20655
87 108 0 8 0.20655
99 164 0 8 0.20145
81 92 0 8 0.1972
99 169 0 8 0.1921
121 188 0 8 0.1819
END