PFRMAT RR TARGET T0261 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MEGLEAYDYHLPPEQIAQEGVEPRDMARLMVVYREGPFRVAHKRVRDLPE FLRPGDVLVFNESKVIPARLLARKPTGGKVEILLVRERSPGLWEALLGPA RKAPPGTRLLLLSPKDLAPVPGLQAEVVAVEEDGVRLLRFQGDLVAHLEE VGEVPLPPYIKAKIPMERYQTVYARRPGSVAAPTAGLHFTPELLERLREM GVELRFLTLHVGPGTFRPVKGDPEKHEMHAEPYAIPEEVAEAVNRAKAEG RRVVAVGTTVVRALESAYREGVGVVAGEGETRLFIRPPYTFKVVDALFTN FHLPRSTLLMLVAAFLGRERTLEAYRLAVAEGYRFYSLGDAMLIL 72 284 0 8 0.53125 25 99 0 8 0.5066 171 202 0 8 0.46155 42 327 0 8 0.3434 56 321 0 8 0.31195 24 171 0 8 0.3026 25 87 0 8 0.2907 217 338 0 8 0.28815 211 311 0 8 0.2771 303 336 0 8 0.26605 171 285 0 8 0.2465 15 329 0 8 0.2448 25 100 0 8 0.24225 99 136 0 8 0.2346 42 333 0 8 0.2346 184 337 0 8 0.23205 181 337 0 8 0.23205 103 204 0 8 0.23205 296 307 0 8 0.2261 72 109 0 8 0.2261 107 204 0 8 0.22185 52 314 0 8 0.22015 21 336 0 8 0.22015 308 337 0 8 0.21675 171 281 0 8 0.21675 71 204 0 8 0.20655 80 138 0 8 0.20145 8 305 0 8 0.1972 188 211 0 8 0.1955 188 311 0 8 0.1921 239 321 0 8 0.1904 25 190 0 8 0.1887 40 112 0 8 0.1802 END