CASP6 Target T0257
- 1. Protein Name
- AAG03475
- 2. Organism Name
- Pseudomonas aeruginosa PAO1
- 3. Number of amino acids (approx)
- 162 aa
- 4. Accession number
- AAG03475
- 5. Sequence Database
- Genbank
-
6. Amino acid sequence
-
MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTK
YIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDR
LTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNVQA
-
7. Additional information
- conserved hypothetical protein
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- electron density / partial proteins
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- 08/31/2004
- 12. Estimated date of public release of structure
- 09/30/2004
Related Files
Template Sequence file
Template PDB file