PFRMAT RR
TARGET T0257
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The predictions are limited to a score >= .18 which
REMARK is an approximation of the probability.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 280 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD NN: NN280-240n300.net.28
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGK
VNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLII
TLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPV
KYGWNIRQNVQA
110 136 0 8 0.55675
98 136 0 8 0.4947
18 68 0 8 0.48705
95 147 0 8 0.4369
68 87 0 8 0.4369
18 87 0 8 0.4267
24 87 0 8 0.42075
68 141 0 8 0.4131
68 136 0 8 0.4131
77 95 0 8 0.4012
32 87 0 8 0.38845
53 129 0 8 0.37825
77 141 0 8 0.36805
73 105 0 8 0.3655
16 76 0 8 0.36295
32 88 0 8 0.3502
55 147 0 8 0.34085
15 87 0 8 0.34085
91 139 0 8 0.3332
16 26 0 8 0.3332
95 141 0 8 0.32385
73 136 0 8 0.3213
15 147 0 8 0.3213
36 73 0 8 0.3162
3 68 0 8 0.3162
15 55 0 8 0.31195
67 88 0 8 0.3043
105 136 0 8 0.3026
77 147 0 8 0.28815
10 87 0 8 0.28645
53 87 0 8 0.2839
115 147 0 8 0.27965
95 105 0 8 0.27285
79 136 0 8 0.2635
16 51 0 8 0.2635
12 51 0 8 0.25925
68 110 0 8 0.25755
74 86 0 8 0.2533
55 139 0 8 0.2533
35 73 0 8 0.2533
61 70 0 8 0.25075
87 114 0 8 0.24905
34 110 0 8 0.24905
38 85 0 8 0.2465
28 152 0 8 0.238
87 115 0 8 0.2363
15 26 0 8 0.2363
15 77 0 8 0.23205
84 154 0 8 0.2278
75 85 0 8 0.2278
3 136 0 8 0.2278
114 148 0 8 0.2244
55 141 0 8 0.22015
36 136 0 8 0.2142
95 148 0 8 0.2125
32 53 0 8 0.2125
27 153 0 8 0.2125
87 141 0 8 0.2108
32 61 0 8 0.2091
76 131 0 8 0.20485
4 18 0 8 0.20485
99 116 0 8 0.20315
136 148 0 8 0.20145
87 134 0 8 0.20145
77 87 0 8 0.19975
32 134 0 8 0.19975
136 147 0 8 0.1955
36 139 0 8 0.1955
36 89 0 8 0.1955
16 139 0 8 0.1938
85 127 0 8 0.1921
18 147 0 8 0.1921
109 136 0 8 0.1904
18 136 0 8 0.1904
43 79 0 8 0.1887
65 87 0 8 0.187
130 147 0 8 0.1853
77 139 0 8 0.1853
73 139 0 8 0.1853
105 114 0 8 0.1836
101 129 0 8 0.1819
36 147 0 8 0.1802
3 18 0 8 0.1802
END