PFRMAT RR TARGET T0254 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MPHLRFRAVEAHIVESLVPTLLNELSSLLSTARNAFTFELINTQYFAEGG VYPMVEVLWFGREQQTQDQIAQVITDQIRQLLGADSHLAVVFIPLQRTAY YLDGQHF 13 27 0 8 0.44115 57 90 0 8 0.41565 58 89 0 8 0.3383 25 36 0 8 0.3094 20 50 0 8 0.3026 73 82 0 8 0.2907 41 58 0 8 0.2907 41 89 0 8 0.25755 29 55 0 8 0.25755 38 78 0 8 0.24905 43 78 0 8 0.2346 9 31 0 8 0.2346 46 93 0 8 0.1887 31 47 0 8 0.1802 END