PFRMAT RR
TARGET T0252
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length
REMARK or to a limited set of high scoring pairs.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 280 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD NN: /projects/compbio/experiments/protein-predict/casp6/networks/NN280-240n300.net.28
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDG
NVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNS
VIALELHGGKPLSPLVNAGAIATTSLINAENVEQRWQRILHIQQQLAGEQ
VALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLL
NTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDW
AYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVA
KQLGYNVFKG
14 142 0 8 0.47685
73 296 0 8 0.4318
208 295 0 8 0.4233
103 112 0 8 0.41055
41 278 0 8 0.4012
15 143 0 8 0.38335
10 52 0 8 0.3655
8 52 0 8 0.3655
86 103 0 8 0.3434
208 303 0 8 0.33065
143 278 0 8 0.33065
258 268 0 8 0.3264
202 268 0 8 0.31875
122 139 0 8 0.31875
235 291 0 8 0.3162
7 52 0 8 0.3145
122 157 0 8 0.31195
14 143 0 8 0.30685
188 268 0 8 0.29495
86 235 0 8 0.29495
200 279 0 8 0.28645
86 102 0 8 0.28645
11 205 0 8 0.27965
211 235 0 8 0.2771
86 233 0 8 0.2771
208 235 0 8 0.27455
139 157 0 8 0.27455
14 202 0 8 0.27455
2 55 0 8 0.27285
166 220 0 8 0.2703
86 112 0 8 0.2703
124 139 0 8 0.2686
73 112 0 8 0.2686
236 306 0 8 0.26605
202 299 0 8 0.2618
250 279 0 8 0.25925
122 220 0 8 0.25925
124 147 0 8 0.25755
188 303 0 8 0.255
171 181 0 8 0.2533
153 277 0 8 0.2533
14 102 0 8 0.2533
73 235 0 8 0.2465
86 180 0 8 0.24225
76 254 0 8 0.24225
250 278 0 8 0.2363
132 178 0 8 0.2346
63 103 0 8 0.2278
173 296 0 8 0.2261
103 180 0 8 0.2261
86 158 0 8 0.2261
194 235 0 8 0.2244
74 211 0 8 0.22185
188 258 0 8 0.22015
46 231 0 8 0.21675
204 230 0 8 0.2142
7 70 0 8 0.2125
123 174 0 8 0.2108
157 220 0 8 0.2091
86 125 0 8 0.20655
10 55 0 8 0.20315
235 295 0 8 0.19975
235 282 0 8 0.19975
235 296 0 8 0.1972
123 158 0 8 0.1972
101 143 0 8 0.1972
14 36 0 8 0.1972
80 220 0 8 0.1921
14 239 0 8 0.1904
139 220 0 8 0.1887
101 278 0 8 0.1887
63 112 0 8 0.1887
52 233 0 8 0.1887
65 197 0 8 0.187
52 183 0 8 0.187
123 142 0 8 0.1853
142 174 0 8 0.1836
14 103 0 8 0.1836
10 32 0 8 0.1819
165 193 0 8 0.1785
52 134 0 8 0.1785
15 40 0 8 0.1785
164 220 0 8 0.1768
135 243 0 8 0.1768
52 185 0 8 0.1768
7 67 0 8 0.1768
4 53 0 8 0.1768
86 149 0 8 0.1751
8 55 0 8 0.1751
7 279 0 8 0.1751
15 239 0 8 0.1734
48 258 0 8 0.1717
53 143 0 8 0.17
END