CASP6 Target T0251
-
1. Protein Name
- NP_374059
-
2. Organism Name
- Staphylococcus aureus subsp. aureus N315
-
3. Number of amino acids (approx)
- 102 aa
-
4. Accession number
- NP_374059
-
5. Sequence Database
- Genbank
-
6. Amino acid sequence
-
MVVYGADVICASCVNAPTSKDIYDWLQPLLKRKYPNISFKYTYIDITKDNDNLTDHDLQF
IERIEQDELFYPLITMNDEYVADGYIQTKQITRFIDQKLVNE
-
7. Additional information
- Conserved hypothetical protein
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
- electron density / partial model
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- 08/31/2004
-
12. Estimated date of public release of structure
- 09/30/2004
Related Files
Template Sequence file
Template PDB file