PFRMAT RR
TARGET T0250
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length
REMARK or to a limited set of high scoring pairs.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 280 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD NN: /projects/compbio/experiments/protein-predict/casp6/networks/NN280-240n300.net.28
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
MTNVLYQHGTLGTLMAGLLEGTATINELLEHGNLGIATLTGSDGEVIFLD
GKAYHANEHKEFIELKGDEKVPYASITNFKASKTFPLQQLSQDDVFAQIK
NEMLSENLFSAVKIYGTFKHMHVRMMPAQQPPYTRLIDSARRQPEEKRQD
IRGAIVGFFTPELFHGVGSAGFHIHFADDERAYGGHVLDFEVDDVVVEIQ
NFETFQQHFPVNNETFVKAKIDYKDVAEEIREAE
3 53 0 8 0.1972
5 153 0 8 0.31875
7 38 0 8 0.1972
8 22 0 8 0.2125
8 190 0 8 0.17
8 207 0 8 0.1717
11 56 0 8 0.35785
11 163 0 8 0.27455
11 190 0 8 0.4947
22 53 0 8 0.1921
25 190 0 8 0.2465
38 72 0 8 0.5117
38 176 0 8 0.187
42 125 0 8 0.2091
47 90 0 8 0.2125
49 111 0 8 0.1921
56 92 0 8 0.29325
65 90 0 8 0.3145
71 113 0 8 0.20315
73 123 0 8 0.187
73 209 0 8 0.1921
77 219 0 8 0.1819
95 158 0 8 0.23205
95 192 0 8 0.2771
103 192 0 8 0.27285
109 205 0 8 0.1819
111 158 0 8 0.2125
111 197 0 8 0.20145
112 174 0 8 0.255
113 169 0 8 0.2125
155 195 0 8 0.30005
170 192 0 8 0.2244
172 192 0 8 0.2448
183 223 0 8 0.1734
END