PFRMAT RR TARGET T0250 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MTNVLYQHGTLGTLMAGLLEGTATINELLEHGNLGIATLTGSDGEVIFLD GKAYHANEHKEFIELKGDEKVPYASITNFKASKTFPLQQLSQDDVFAQIK NEMLSENLFSAVKIYGTFKHMHVRMMPAQQPPYTRLIDSARRQPEEKRQD IRGAIVGFFTPELFHGVGSAGFHIHFADDERAYGGHVLDFEVDDVVVEIQ NFETFQQHFPVNNETFVKAKIDYKDVAEEIREAE 38 72 0 8 0.5117 11 190 0 8 0.4947 11 56 0 8 0.35785 5 153 0 8 0.31875 65 90 0 8 0.3145 155 195 0 8 0.30005 56 92 0 8 0.29325 95 192 0 8 0.2771 11 163 0 8 0.27455 103 192 0 8 0.27285 112 174 0 8 0.255 25 190 0 8 0.2465 172 192 0 8 0.2448 95 158 0 8 0.23205 170 192 0 8 0.2244 113 169 0 8 0.2125 111 158 0 8 0.2125 47 90 0 8 0.2125 8 22 0 8 0.2125 42 125 0 8 0.2091 71 113 0 8 0.20315 111 197 0 8 0.20145 7 38 0 8 0.1972 3 53 0 8 0.1972 73 209 0 8 0.1921 49 111 0 8 0.1921 22 53 0 8 0.1921 73 123 0 8 0.187 38 176 0 8 0.187 109 205 0 8 0.1819 77 219 0 8 0.1819 END