CASP6 Target T0249
-
1. Protein Name
- 1371B
-
2. Organism Name
- Chlorobium tepidum TLS
-
3. Number of amino acids (approx)
- 209
-
4. Accession number
- AAM71720.1
-
5. Sequence Database
- Genbank
-
6. Amino acid sequence
-
MQEQRQQLLRSLEALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEATGRTFR
IHAIAGGYRFLTEPEFADLVRQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGA
SPDYSIDRLLARGLIEVRGRADSPGRPLQYGTTEVFLDLFHLPSLKDLPKLREIKEILQE
HEEQQYLAADGDLPVAADEDEKPRMERIE
-
7. Additional information
-
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
- Completed
-
10. Interpretable map?
- no
-
11. Estimated date of chain tracing completion
- completed
-
12. Estimated date of public release of structure
- After September 1
Related Files
Template Sequence file
Template PDB file