PFRMAT RR TARGET T0249 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MQEQRQQLLRSLEALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNR DYEATGRTFRIHAIAGGYRFLTEPEFADLVRQLLAPVIQRRLSRSMLEVL AVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPGRPLQY GTTEVFLDLFHLPSLKDLPKLREIKEILQEHEEQQYLAADGDLPVAADED EKPRMERIE 98 110 0 8 0.63155 98 111 0 8 0.62815 22 67 0 8 0.6137 147 157 0 8 0.59925 111 120 0 8 0.54995 98 120 0 8 0.5066 152 162 0 8 0.4998 61 70 0 8 0.4845 72 102 0 8 0.48195 91 115 0 8 0.4539 98 125 0 8 0.4488 120 157 0 8 0.42925 98 115 0 8 0.42075 91 120 0 8 0.42075 72 150 0 8 0.41565 115 157 0 8 0.3961 61 134 0 8 0.3859 111 157 0 8 0.37315 110 157 0 8 0.34765 69 137 0 8 0.34765 98 114 0 8 0.3434 115 125 0 8 0.34085 111 125 0 8 0.3264 72 122 0 8 0.3213 98 128 0 8 0.3145 71 141 0 8 0.3145 72 157 0 8 0.31195 106 132 0 8 0.3094 99 122 0 8 0.3094 102 117 0 8 0.30685 70 134 0 8 0.30685 61 165 0 8 0.30685 98 137 0 8 0.3043 61 157 0 8 0.30005 17 72 0 8 0.2975 110 147 0 8 0.29325 59 70 0 8 0.29325 98 134 0 8 0.2907 72 134 0 8 0.2907 111 147 0 8 0.28135 98 157 0 8 0.28135 15 72 0 8 0.28135 125 134 0 8 0.27965 114 134 0 8 0.2771 18 134 0 8 0.2771 125 157 0 8 0.27455 107 157 0 8 0.2686 95 157 0 8 0.2686 22 68 0 8 0.2686 134 147 0 8 0.26605 128 149 0 8 0.26605 103 114 0 8 0.26605 125 147 0 8 0.2635 91 111 0 8 0.25925 102 114 0 8 0.255 98 123 0 8 0.255 87 115 0 8 0.2533 98 121 0 8 0.2465 125 149 0 8 0.2448 98 122 0 8 0.24225 115 144 0 8 0.238 150 165 0 8 0.2363 111 134 0 8 0.2346 64 162 0 8 0.2346 115 146 0 8 0.23205 111 128 0 8 0.23205 111 144 0 8 0.2278 71 103 0 8 0.2278 52 80 0 8 0.2278 94 134 0 8 0.2244 111 165 0 8 0.22185 102 120 0 8 0.22015 18 152 0 8 0.22015 58 162 0 8 0.21845 57 111 0 8 0.21845 98 117 0 8 0.21675 22 66 0 8 0.21675 120 144 0 8 0.2142 92 134 0 8 0.2142 98 149 0 8 0.2125 115 128 0 8 0.2091 105 149 0 8 0.2091 135 168 0 8 0.20655 134 157 0 8 0.20655 122 134 0 8 0.20485 102 125 0 8 0.20485 147 165 0 8 0.20315 91 157 0 8 0.20315 134 150 0 8 0.20145 87 146 0 8 0.19975 69 125 0 8 0.1972 137 148 0 8 0.1955 124 157 0 8 0.1921 31 149 0 8 0.1921 22 71 0 8 0.1904 112 125 0 8 0.1887 137 149 0 8 0.187 44 149 0 8 0.187 22 141 0 8 0.187 127 159 0 8 0.1853 115 134 0 8 0.1853 70 102 0 8 0.1853 120 137 0 8 0.1836 115 147 0 8 0.1836 115 141 0 8 0.1836 111 150 0 8 0.1836 110 134 0 8 0.1836 102 157 0 8 0.1819 45 162 0 8 0.1819 130 159 0 8 0.1802 END