PFRMAT RR TARGET T0248 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MINKPNQFVNHLSALKKHFASYKELREAFNDYHKHNGDELTTFFLHQFDK VMELVKQKDFKTAQSRCEEELAAPYLPKPLVSFFQSLLQLVNHDLLEQQN AALASLPAAKIIELVLQDYPNKLNMIHYLLPKTKAFVKPHLLQRLQFVLT DSELLELKRFSFFQALNQIPGFQGEQVEYFNSKLKQKFTLTLGEFEIAQQ PDAKAYFEQLITQIQQLFLKEPVNAEFANEIIDAFLVSYFPLHPPVPLAQ LAAKIYEYVSQIVLNEAVNLKDELIKLIVHTLYEQLDRPVGDEN 236 262 0 8 0.6392 262 283 0 8 0.4012 236 283 0 8 0.3859 125 167 0 8 0.34595 217 283 0 8 0.3213 234 283 0 8 0.3162 263 277 0 8 0.3094 217 262 0 8 0.27965 165 227 0 8 0.27965 254 283 0 8 0.2771 112 169 0 8 0.25075 262 277 0 8 0.2448 242 283 0 8 0.23035 268 283 0 8 0.22015 263 283 0 8 0.20485 227 237 0 8 0.1904 213 246 0 8 0.1887 148 162 0 8 0.1853 217 254 0 8 0.1836 119 277 0 8 0.1836 234 262 0 8 0.1819 92 270 0 8 0.1819 END