CASP6 Target T0245
-
1. Protein Name
- AF2059
-
2. Organism Name
- Archaeoglobus fulgidus
-
3. Number of amino acids (approx)
- 196
-
4. Accession number
- AAB89192
-
5. Sequence Database
- Genbank
-
6. Amino acid sequence
-
MMWEQFKKEKLRGYLEAKNQRKVDFDIVELLDLINSFDDFVTLSSCSGRIAVVDLEKPGD
KASSLFLGKWHEGVEVSEVAEAALRSRKVAWLIQYPPIIHVACRNIGAAKLLMNAANTAG
FRRSGVISLSNYVVEIASLERIELPVAEKGLMLVDDAYLSYVVRWANEKLLKGKEKLGRL
QEALESLQRENAYCSD
-
7. Additional information
-
JCSG target 2648472
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
- 2.7A MAD dataset collected, 80% of main chain traced, refinement in progress
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- completed
-
12. Estimated date of public release of structure
- after September 1
Related Files
Template Sequence file
Template PDB file