PFRMAT RR
TARGET T0245
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The predictions are limited to a score >= .18 which
REMARK is an approximation of the probability.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 280 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD NN: NN280-240n300.net.28
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
MMWEQFKKEKLRGYLEAKNQRKVDFDIVELLDLINSFDDFVTLSSCSGRI
AVVDLEKPGDKASSLFLGKWHEGVEVSEVAEAALRSRKVAWLIQYPPIIH
VACRNIGAAKLLMNAANTAGFRRSGVISLSNYVVEIASLERIELPVAEKG
LMLVDDAYLSYVVRWANEKLLKGKEKLGRLQEALESLQRENAYCSD
2 171 0 8 0.5865
52 134 0 8 0.56865
69 170 0 8 0.5219
96 123 0 8 0.4998
74 117 0 8 0.4369
19 96 0 8 0.42075
18 173 0 8 0.40375
64 170 0 8 0.38845
19 123 0 8 0.3604
94 117 0 8 0.35785
31 64 0 8 0.33575
51 123 0 8 0.31875
6 74 0 8 0.31875
64 132 0 8 0.28645
69 135 0 8 0.28135
79 144 0 8 0.27455
6 123 0 8 0.2703
74 123 0 8 0.2686
10 31 0 8 0.255
53 64 0 8 0.2533
64 123 0 8 0.25075
95 173 0 8 0.24225
74 122 0 8 0.24055
10 41 0 8 0.2363
83 162 0 8 0.2346
152 188 0 8 0.23205
123 170 0 8 0.2278
64 93 0 8 0.2278
10 123 0 8 0.2244
123 140 0 8 0.21845
115 126 0 8 0.21845
74 94 0 8 0.21675
105 140 0 8 0.2142
69 122 0 8 0.2142
2 170 0 8 0.2091
43 142 0 8 0.20655
123 147 0 8 0.20145
6 72 0 8 0.20145
52 68 0 8 0.19975
74 118 0 8 0.1972
10 140 0 8 0.1955
63 105 0 8 0.1921
33 153 0 8 0.1904
68 115 0 8 0.1887
18 96 0 8 0.1887
72 123 0 8 0.1836
53 95 0 8 0.1819
2 152 0 8 0.1802
END