CASP6 Target T0243

1. Protein Name: F93
2. Organism Name: Sulfolobus turreted icosahedral virus
3. Number of amino acids (approx): 93
4. Accession number: YP_025013
5. Sequence Database
6. Amino acid sequence: MKIRKYMRINYYIILKVLVINGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKIL
REEEAPDGKVLFLTEKGMKEFEELHEFFKKIVC
7. Additional information
8. X-ray structure: yes
9. Current state of the experimental work: We are building the model to 2.4 A and it is ~60% complete.
The electron density is continuous so we expect to have a fairly complete model shortly (at least the main chain will be complete).
Biochemical work also is in progress to determine the function of this protein prior to release and/or publication.
10. Interpretable map?: yes
11. Estimated date of chain tracing completion: 8/1/04
12. Estimated date of public release of structure: 9/1/04