PFRMAT RR TARGET T0241 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: /projects/compbio/experiments/protein-predict/casp6/networks/NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 PKNVLFQYSTINALMLGQFEGDLTLKDLKLRGDMGLGTINDLDGEMIQMG TKFYQIDSTGKLSELPESVKTPFAVTTHFEPKEKTTLTNVQDYNQLTKML EEKFENKNVFYAVKLTGTFKMVKARTVPKQTRPYPQLTEVTKKQSEFEFK NVKGTLIGFYTPNYAAALNVPGFHLHFITEDKTSGGHVLNLQFDNANLEI SPIHEFDVQLPHTDDFAHSDLTQVTTSQVHQAESERK 38 72 0 8 0.56865 75 193 0 8 0.3961 11 191 0 8 0.3859 11 56 0 8 0.3604 203 214 0 8 0.3094 11 164 0 8 0.29325 112 198 0 8 0.2618 34 193 0 8 0.2618 39 193 0 8 0.255 79 114 0 8 0.2533 112 159 0 8 0.2346 23 193 0 8 0.2278 8 22 0 8 0.2261 110 206 0 8 0.22185 78 114 0 8 0.22185 28 110 0 8 0.22185 73 140 0 8 0.22015 65 110 0 8 0.20315 34 196 0 8 0.1972 77 159 0 8 0.1955 53 184 0 8 0.1955 31 124 0 8 0.1955 171 193 0 8 0.1921 140 210 0 8 0.1819 103 114 0 8 0.1802 73 210 0 8 0.1802 END