PFRMAT RR TARGET T0241 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximate of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artifical neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 PKNVLFQYSTINALMLGQFEGDLTLKDLKLRGDMGLGTINDLDGEMIQMG TKFYQIDSTGKLSELPESVKTPFAVTTHFEPKEKTTLTNVQDYNQLTKML EEKFENKNVFYAVKLTGTFKMVKARTVPKQTRPYPQLTEVTKKQSEFEFK NVKGTLIGFYTPNYAAALNVPGFHLHFITEDKTSGGHVLNLQFDNANLEI SPIHEFDVQLPHTDDFAHSDLTQVTTSQVHQAESERK 38 72 0 8 0.389 8 46 0 8 0.259 8 22 0 8 0.259 75 171 0 8 0.252 73 140 0 8 0.243 10 38 0 8 0.239 7 38 0 8 0.239 15 64 0 8 0.23 25 62 0 8 0.228 75 98 0 8 0.226 4 75 0 8 0.226 112 198 0 8 0.222 22 40 0 8 0.222 203 214 0 8 0.22 11 56 0 8 0.218 40 62 0 8 0.216 22 62 0 8 0.216 11 164 0 8 0.216 11 191 0 8 0.214 75 193 0 8 0.21 7 72 0 8 0.21 71 114 0 8 0.208 20 64 0 8 0.208 10 72 0 8 0.208 143 222 0 8 0.206 99 121 0 8 0.206 3 64 0 8 0.206 73 210 0 8 0.202 53 63 0 8 0.202 127 149 0 8 0.2 66 99 0 8 0.2 91 205 0 8 0.196 41 93 0 8 0.196 34 193 0 8 0.196 49 75 0 8 0.194 14 77 0 8 0.194 11 93 0 8 0.194 30 59 0 8 0.192 26 58 0 8 0.192 23 83 0 8 0.192 14 161 0 8 0.192 46 60 0 8 0.191 91 193 0 8 0.189 23 193 0 8 0.189 135 193 0 8 0.187 62 80 0 8 0.187 49 63 0 8 0.187 30 61 0 8 0.187 14 120 0 8 0.187 8 184 0 8 0.187 156 222 0 8 0.185 41 75 0 8 0.185 15 71 0 8 0.185 13 46 0 8 0.183 11 160 0 8 0.183 97 193 0 8 0.181 39 193 0 8 0.181 9 74 0 8 0.181 165 209 0 8 0.18 23 60 0 8 0.18 11 202 0 8 0.18 88 151 0 8 0.178 11 89 0 8 0.178 110 206 0 8 0.176 75 205 0 8 0.176 18 121 0 8 0.176 1 22 0 8 0.176 6 118 0 8 0.174 11 100 0 8 0.173 88 163 0 8 0.171 64 79 0 8 0.171 57 195 0 8 0.171 53 184 0 8 0.171 52 89 0 8 0.171 46 124 0 8 0.171 40 201 0 8 0.171 8 68 0 8 0.171 179 193 0 8 0.169 152 196 0 8 0.169 148 208 0 8 0.169 103 114 0 8 0.169 87 150 0 8 0.169 87 143 0 8 0.169 78 123 0 8 0.169 63 138 0 8 0.169 63 99 0 8 0.169 12 105 0 8 0.169 8 124 0 8 0.169 127 170 0 8 0.168 91 166 0 8 0.168 77 118 0 8 0.168 31 41 0 8 0.168 26 84 0 8 0.168 1 184 0 8 0.168 1 68 0 8 0.168 121 168 0 8 0.166 93 124 0 8 0.166 61 196 0 8 0.166 50 198 0 8 0.166 18 201 0 8 0.166 11 204 0 8 0.166 9 159 0 8 0.166 1 124 0 8 0.166 171 193 0 8 0.164 111 122 0 8 0.164 78 202 0 8 0.164 77 159 0 8 0.164 59 222 0 8 0.164 13 55 0 8 0.164 93 184 0 8 0.163 78 114 0 8 0.163 31 124 0 8 0.163 20 136 0 8 0.163 16 150 0 8 0.163 175 214 0 8 0.161 137 199 0 8 0.161 118 222 0 8 0.161 101 150 0 8 0.161 END