PFRMAT RR TARGET T0238 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MKKAKLNIIKINIIAMILTLICTSCAPFSKIDPKANANTKPKKITNPGEN TQNFEDKSGDLSTSDEKIMETIASELKAIGKELEDQKKEENIQIAKIAKE KFDFLSTFKVGPYDLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILK KNSEHYNIIGRLIYHISWGIQFQIEQNLELIQNGVENLSQEESKSLLMQI KSNLEIKQRLKKTLNETLKVYNQNTQDNEKILAEHFNKYYKDFDTLKPAF Y 154 250 0 8 0.6868 154 239 0 8 0.47685 77 239 0 8 0.3604 239 250 0 8 0.3026 132 142 0 8 0.27285 156 188 0 8 0.2618 20 221 0 8 0.2142 163 240 0 8 0.20655 172 239 0 8 0.20315 156 177 0 8 0.20315 165 177 0 8 0.1972 111 200 0 8 0.1972 38 115 0 8 0.1938 33 45 0 8 0.1853 END