PFRMAT RR TARGET T0238 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximate of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artifical neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 MKKAKLNIIKINIIAMILTLICTSCAPFSKIDPKANANTKPKKITNPGEN TQNFEDKSGDLSTSDEKIMETIASELKAIGKELEDQKKEENIQIAKIAKE KFDFLSTFKVGPYDLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILK KNSEHYNIIGRLIYHISWGIQFQIEQNLELIQNGVENLSQEESKSLLMQI KSNLEIKQRLKKTLNETLKVYNQNTQDNEKILAEHFNKYYKDFDTLKPAF Y 127 176 0 8 0.445 38 115 0 8 0.392 121 216 0 8 0.35 187 247 0 8 0.3 156 177 0 8 0.298 59 229 0 8 0.283 136 173 0 8 0.276 21 42 0 8 0.259 45 105 0 8 0.257 72 216 0 8 0.248 154 250 0 8 0.237 46 174 0 8 0.235 155 173 0 8 0.232 115 172 0 8 0.23 106 192 0 8 0.23 165 177 0 8 0.228 16 124 0 8 0.226 157 250 0 8 0.224 150 165 0 8 0.224 92 117 0 8 0.224 156 188 0 8 0.22 122 173 0 8 0.22 59 174 0 8 0.218 32 46 0 8 0.218 106 137 0 8 0.216 111 200 0 8 0.214 112 217 0 8 0.212 68 126 0 8 0.212 80 247 0 8 0.208 86 191 0 8 0.206 141 197 0 8 0.204 112 141 0 8 0.204 69 191 0 8 0.204 37 213 0 8 0.204 89 112 0 8 0.202 87 223 0 8 0.202 77 176 0 8 0.202 164 189 0 8 0.2 150 173 0 8 0.2 55 115 0 8 0.2 15 59 0 8 0.2 113 190 0 8 0.194 77 127 0 8 0.194 172 183 0 8 0.192 163 240 0 8 0.192 26 111 0 8 0.192 112 124 0 8 0.191 120 187 0 8 0.189 20 221 0 8 0.189 112 197 0 8 0.187 104 113 0 8 0.187 101 173 0 8 0.187 21 92 0 8 0.187 137 192 0 8 0.185 112 122 0 8 0.185 55 137 0 8 0.185 41 88 0 8 0.185 230 250 0 8 0.183 159 179 0 8 0.183 132 142 0 8 0.183 122 230 0 8 0.183 122 229 0 8 0.183 43 69 0 8 0.183 27 148 0 8 0.183 122 223 0 8 0.181 65 88 0 8 0.181 27 197 0 8 0.181 161 172 0 8 0.18 151 213 0 8 0.18 114 187 0 8 0.18 108 157 0 8 0.18 80 187 0 8 0.18 38 55 0 8 0.18 16 35 0 8 0.18 92 108 0 8 0.178 64 77 0 8 0.178 59 223 0 8 0.178 119 245 0 8 0.176 114 154 0 8 0.176 99 155 0 8 0.176 87 211 0 8 0.176 54 108 0 8 0.176 34 115 0 8 0.176 158 172 0 8 0.174 172 239 0 8 0.173 85 203 0 8 0.173 61 165 0 8 0.173 37 57 0 8 0.173 200 228 0 8 0.171 59 227 0 8 0.171 20 86 0 8 0.171 71 152 0 8 0.169 63 168 0 8 0.169 78 108 0 8 0.168 154 239 0 8 0.166 120 247 0 8 0.166 32 174 0 8 0.166 31 112 0 8 0.166 27 41 0 8 0.166 125 167 0 8 0.164 85 106 0 8 0.164 57 111 0 8 0.164 41 106 0 8 0.164 29 165 0 8 0.164 155 168 0 8 0.163 235 250 0 8 0.159 151 219 0 8 0.159 141 194 0 8 0.159 106 185 0 8 0.159 88 166 0 8 0.159 74 221 0 8 0.159 72 91 0 8 0.159 49 107 0 8 0.159 106 153 0 8 0.158 91 169 0 8 0.158 85 221 0 8 0.158 85 165 0 8 0.158 71 112 0 8 0.158 57 112 0 8 0.158 137 220 0 8 0.156 111 155 0 8 0.156 71 111 0 8 0.156 65 165 0 8 0.156 34 60 0 8 0.156 26 115 0 8 0.156 END