PFRMAT RR TARGET T0237 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length REMARK or to a limited set of high scoring pairs. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 PTVERSTRMSNPWKAFMEKYDIERTHSSGVRVDLGEDAEVENAKYRIPAG RCPVFGKGIVIENSDVSFLRPVATGDQKLKDGGFAFPNANDHISPMTLAN LKERYKDNVEMMKLNDIALCRTHAASFVMAGDQNSSYRHPAVYDEKEKTC HMLYLSAQENMGPRYCSPDAQNRDAVFCFKPDKNESFENLVYLSKNVRND WDKKCPRKNLGNAKFGLWVDGNCEEIPYVKEVEAEDLRECNRIVFGASAS DQPTQYEEEMTDYQKIQQGFRQNNREMIKSAFLPVGAFNSDNFKSKGRGF NWANFDSVKKKCYIFNTKPTCLINDKNFIATTALSHPQEVDLEFPCSIYK DEIEREIKKQSRNMNLYSVDGERIVLPRIFISNDKESIKCPCEPERISNS TCNFYVCNCVEKRAEIKENNQVVIKEEFRDYYENGEEKSNKQMLL 3 187 0 8 0.1836 4 187 0 8 0.24055 11 144 0 8 0.22185 11 196 0 8 0.1717 12 120 0 8 0.1938 12 154 0 8 0.1938 31 72 0 8 0.187 31 73 0 8 0.29325 31 77 0 8 0.20145 31 151 0 8 0.1887 31 193 0 8 0.2346 32 123 0 8 0.17 32 218 0 8 0.2907 37 73 0 8 0.255 37 77 0 8 0.34765 37 106 0 8 0.23035 38 73 0 8 0.187 38 107 0 8 0.25755 41 66 0 8 0.1887 58 73 0 8 0.17 58 220 0 8 0.3213 67 149 0 8 0.20315 72 214 0 8 0.1768 73 94 0 8 0.2363 73 106 0 8 0.33575 73 107 0 8 0.3553 73 151 0 8 0.22185 73 177 0 8 0.2261 73 193 0 8 0.3808 73 214 0 8 0.2907 73 219 0 8 0.27965 73 220 0 8 0.1921 74 106 0 8 0.24225 93 115 0 8 0.2907 102 149 0 8 0.33575 105 123 0 8 0.1887 107 214 0 8 0.5117 111 155 0 8 0.1768 117 127 0 8 0.28645 122 136 0 8 0.2125 122 145 0 8 0.17 122 187 0 8 0.1836 123 137 0 8 0.27285 127 139 0 8 0.2448 127 155 0 8 0.24055 136 145 0 8 0.21845 136 149 0 8 0.30005 137 218 0 8 0.1887 144 196 0 8 0.22015 151 193 0 8 0.20145 356 381 0 8 0.26605 357 381 0 8 0.29325 357 406 0 8 0.1955 END