PFRMAT RR TARGET T0237 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 PTVERSTRMSNPWKAFMEKYDIERTHSSGVRVDLGEDAEVENAKYRIPAG RCPVFGKGIVIENSDVSFLRPVATGDQKLKDGGFAFPNANDHISPMTLAN LKERYKDNVEMMKLNDIALCRTHAASFVMAGDQNSSYRHPAVYDEKEKTC HMLYLSAQENMGPRYCSPDAQNRDAVFCFKPDKNESFENLVYLSKNVRND WDKKCPRKNLGNAKFGLWVDGNCEEIPYVKEVEAEDLRECNRIVFGASAS DQPTQYEEEMTDYQKIQQGFRQNNREMIKSAFLPVGAFNSDNFKSKGRGF NWANFDSVKKKCYIFNTKPTCLINDKNFIATTALSHPQEVDLEFPCSIYK DEIEREIKKQSRNMNLYSVDGERIVLPRIFISNDKESIKCPCEPERISNS TCNFYVCNCVEKRAEIKENNQVVIKEEFRDYYENGEEKSNKQMLL 107 214 0 8 0.5117 73 193 0 8 0.3808 73 107 0 8 0.3553 37 77 0 8 0.34765 102 149 0 8 0.33575 73 106 0 8 0.33575 58 220 0 8 0.3213 136 149 0 8 0.30005 357 381 0 8 0.29325 31 73 0 8 0.29325 93 115 0 8 0.2907 73 214 0 8 0.2907 32 218 0 8 0.2907 117 127 0 8 0.28645 73 219 0 8 0.27965 123 137 0 8 0.27285 356 381 0 8 0.26605 38 107 0 8 0.25755 37 73 0 8 0.255 127 139 0 8 0.2448 74 106 0 8 0.24225 127 155 0 8 0.24055 4 187 0 8 0.24055 73 94 0 8 0.2363 31 193 0 8 0.2346 37 106 0 8 0.23035 73 177 0 8 0.2261 73 151 0 8 0.22185 11 144 0 8 0.22185 144 196 0 8 0.22015 136 145 0 8 0.21845 122 136 0 8 0.2125 67 149 0 8 0.20315 151 193 0 8 0.20145 31 77 0 8 0.20145 357 406 0 8 0.1955 12 154 0 8 0.1938 12 120 0 8 0.1938 73 220 0 8 0.1921 137 218 0 8 0.1887 105 123 0 8 0.1887 41 66 0 8 0.1887 31 151 0 8 0.1887 38 73 0 8 0.187 31 72 0 8 0.187 122 187 0 8 0.1836 3 187 0 8 0.1836 END