PFRMAT RR
TARGET T0234
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MSQLEKAQAEYAGFIQEFQSAIISTISEQGIPNGSYAPFVIDDAKNIYIY
VSGLAVHTKNIEANPLVNVLFVDDEAKTNQIFARRRLSFDCTATLIERES
QKWNQVVDQFQERFGQIIEVLRGLADFRIFQLTPKEGRFVIGFGAAYHIS
GDRLDTLVPITGDKG
50 86 0 8 0.472
22 70 0 8 0.439
57 86 0 8 0.427
21 69 0 8 0.424
35 55 0 8 0.421
25 60 0 8 0.421
37 57 0 8 0.415
68 88 0 8 0.404
35 60 0 8 0.404
55 70 0 8 0.401
114 129 0 8 0.398
24 68 0 8 0.395
55 86 0 8 0.384
39 71 0 8 0.384
57 130 0 8 0.378
55 88 0 8 0.372
89 131 0 8 0.367
47 89 0 8 0.367
22 34 0 8 0.358
50 127 0 8 0.356
18 48 0 8 0.356
67 132 0 8 0.353
52 86 0 8 0.353
35 57 0 8 0.353
54 86 0 8 0.35
50 140 0 8 0.35
33 57 0 8 0.347
38 86 0 8 0.345
70 86 0 8 0.342
58 70 0 8 0.342
35 86 0 8 0.337
35 50 0 8 0.337
14 88 0 8 0.334
35 58 0 8 0.331
47 86 0 8 0.329
34 68 0 8 0.329
52 127 0 8 0.323
38 50 0 8 0.318
14 50 0 8 0.316
50 70 0 8 0.313
47 129 0 8 0.313
37 86 0 8 0.313
54 127 0 8 0.31
40 50 0 8 0.31
21 37 0 8 0.305
20 36 0 8 0.303
68 90 0 8 0.3
19 35 0 8 0.3
86 138 0 8 0.298
86 127 0 8 0.298
57 68 0 8 0.298
55 127 0 8 0.298
37 47 0 8 0.298
86 140 0 8 0.295
58 86 0 8 0.295
51 67 0 8 0.295
58 68 0 8 0.293
35 51 0 8 0.293
42 57 0 8 0.29
20 35 0 8 0.29
67 86 0 8 0.288
39 50 0 8 0.288
38 55 0 8 0.288
35 140 0 8 0.288
22 68 0 8 0.288
50 138 0 8 0.285
47 67 0 8 0.285
26 89 0 8 0.285
22 71 0 8 0.285
11 70 0 8 0.285
21 54 0 8 0.283
14 86 0 8 0.283
98 131 0 8 0.28
57 138 0 8 0.28
50 68 0 8 0.28
38 137 0 8 0.28
15 132 0 8 0.28
35 109 0 8 0.278
22 39 0 8 0.278
47 69 0 8 0.276
33 70 0 8 0.276
15 67 0 8 0.276
END