PFRMAT RR TARGET T0232 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length REMARK or to a limited set of high scoring pairs. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MEDGMNTFDLYYWPVPFRGQLIRGILAHCGCSWDEHDVDAIEGLMDCGAE KQPVAFMGPPVLIDRERNFAISQMPAIAIYLGERLDILPATVEGRTLSAK IVNDANDVLDELTLNGGREMWTPEKWQEFVPRLQKWIRIFADTGARNGLS AASGFMLGTEKIGVADIVTAILWTTVADRFPAIKGIIEDTSPIIWGLSRR VVATAPLAALNSKSFEEYGNAYCGGEIEKSLRKVAS 8 62 0 8 0.8024 28 204 0 8 0.7412 29 82 0 8 0.62815 29 81 0 8 0.595 25 87 0 8 0.5525 79 99 0 8 0.5474 79 210 0 8 0.5338 80 99 0 8 0.5287 69 93 0 8 0.5236 162 197 0 8 0.50915 21 73 0 8 0.4947 101 143 0 8 0.4896 18 143 0 8 0.48705 164 210 0 8 0.4845 18 197 0 8 0.48195 167 197 0 8 0.4743 79 100 0 8 0.47175 8 64 0 8 0.47175 35 210 0 8 0.4692 76 96 0 8 0.46155 21 169 0 8 0.459 8 35 0 8 0.459 141 193 0 8 0.4539 8 33 0 8 0.4539 19 197 0 8 0.45135 28 206 0 8 0.4488 9 36 0 8 0.4318 35 64 0 8 0.4267 18 82 0 8 0.4267 35 73 0 8 0.42075 35 55 0 8 0.41565 140 167 0 8 0.4063 64 93 0 8 0.4012 21 74 0 8 0.39865 35 79 0 8 0.38845 17 73 0 8 0.38845 28 162 0 8 0.3808 22 78 0 8 0.3808 27 204 0 8 0.37825 19 82 0 8 0.37825 78 99 0 8 0.3757 29 204 0 8 0.3655 162 204 0 8 0.36295 69 92 0 8 0.3604 26 210 0 8 0.3604 9 63 0 8 0.3553 73 210 0 8 0.34765 62 105 0 8 0.34765 29 206 0 8 0.34595 16 197 0 8 0.3434 61 72 0 8 0.3383 22 74 0 8 0.3332 9 34 0 8 0.3332 80 102 0 8 0.33065 18 73 0 8 0.33065 154 200 0 8 0.3281 35 57 0 8 0.3281 140 194 0 8 0.3264 79 98 0 8 0.3264 35 72 0 8 0.32385 29 207 0 8 0.32385 20 73 0 8 0.31875 26 81 0 8 0.3162 19 73 0 8 0.3145 64 108 0 8 0.31195 8 118 0 8 0.31195 22 169 0 8 0.30685 73 197 0 8 0.3043 10 171 0 8 0.3043 62 81 0 8 0.3026 25 201 0 8 0.30005 22 170 0 8 0.30005 51 72 0 8 0.2975 28 207 0 8 0.2975 55 210 0 8 0.29325 156 170 0 8 0.2907 51 61 0 8 0.2907 29 72 0 8 0.2907 11 54 0 8 0.2907 197 207 0 8 0.2839 136 210 0 8 0.28135 22 98 0 8 0.28135 22 62 0 8 0.2771 16 55 0 8 0.2771 16 169 0 8 0.27455 163 198 0 8 0.27285 101 197 0 8 0.27285 70 79 0 8 0.27285 35 70 0 8 0.2703 29 136 0 8 0.2703 8 31 0 8 0.2703 22 101 0 8 0.2686 11 29 0 8 0.2686 82 210 0 8 0.2618 29 64 0 8 0.2618 15 170 0 8 0.2618 73 136 0 8 0.25925 57 210 0 8 0.25925 29 210 0 8 0.25925 76 157 0 8 0.255 22 197 0 8 0.2533 27 210 0 8 0.25075 73 207 0 8 0.24905 140 207 0 8 0.2465 19 61 0 8 0.24225 8 61 0 8 0.24225 28 82 0 8 0.24055 61 157 0 8 0.238 59 73 0 8 0.238 167 207 0 8 0.2363 156 201 0 8 0.2363 22 167 0 8 0.2363 9 61 0 8 0.2363 33 166 0 8 0.2346 168 198 0 8 0.23205 18 86 0 8 0.23205 25 140 0 8 0.23035 18 81 0 8 0.23035 21 62 0 8 0.2278 58 67 0 8 0.2261 16 139 0 8 0.2261 162 201 0 8 0.2244 22 210 0 8 0.2244 17 197 0 8 0.22185 156 197 0 8 0.22015 73 169 0 8 0.22015 70 100 0 8 0.22015 194 207 0 8 0.21845 57 88 0 8 0.21845 26 82 0 8 0.21845 176 210 0 8 0.21675 87 174 0 8 0.21675 76 210 0 8 0.21675 75 204 0 8 0.21675 35 47 0 8 0.21675 29 100 0 8 0.21675 21 47 0 8 0.21675 197 210 0 8 0.2142 171 204 0 8 0.2142 69 100 0 8 0.2142 8 98 0 8 0.2142 22 207 0 8 0.2125 15 210 0 8 0.2125 141 192 0 8 0.2108 98 163 0 8 0.2108 63 204 0 8 0.2108 58 72 0 8 0.2108 21 197 0 8 0.2108 16 82 0 8 0.2108 168 201 0 8 0.2091 164 197 0 8 0.2091 8 37 0 8 0.2091 83 95 0 8 0.20655 59 164 0 8 0.20655 25 78 0 8 0.20655 18 85 0 8 0.20655 45 57 0 8 0.20485 29 162 0 8 0.20485 64 88 0 8 0.20315 17 144 0 8 0.20315 64 210 0 8 0.20145 38 61 0 8 0.20145 10 170 0 8 0.20145 23 210 0 8 0.19975 22 73 0 8 0.19975 25 101 0 8 0.1972 14 70 0 8 0.1972 156 165 0 8 0.1955 105 136 0 8 0.1955 78 170 0 8 0.1955 33 167 0 8 0.1955 22 72 0 8 0.1955 16 89 0 8 0.1955 15 169 0 8 0.1955 9 35 0 8 0.1955 105 170 0 8 0.1938 59 210 0 8 0.1938 29 76 0 8 0.1938 10 105 0 8 0.1938 98 157 0 8 0.1921 37 103 0 8 0.1921 26 207 0 8 0.1921 167 210 0 8 0.1904 8 26 0 8 0.1904 22 59 0 8 0.1887 20 169 0 8 0.1887 25 207 0 8 0.187 20 88 0 8 0.187 16 73 0 8 0.187 78 168 0 8 0.1853 71 95 0 8 0.1853 25 71 0 8 0.1853 23 157 0 8 0.1853 16 183 0 8 0.1853 163 201 0 8 0.1836 98 167 0 8 0.1836 92 207 0 8 0.1836 31 141 0 8 0.1836 18 70 0 8 0.1836 17 82 0 8 0.1836 16 182 0 8 0.1836 12 105 0 8 0.1836 109 170 0 8 0.1819 36 63 0 8 0.1819 35 82 0 8 0.1819 29 137 0 8 0.1819 28 167 0 8 0.1819 16 76 0 8 0.1819 64 85 0 8 0.1802 25 98 0 8 0.1802 133 207 0 8 0.1785 82 99 0 8 0.1785 59 169 0 8 0.1785 55 121 0 8 0.1785 38 62 0 8 0.1785 19 62 0 8 0.1785 17 47 0 8 0.1785 105 207 0 8 0.1768 88 210 0 8 0.1768 78 201 0 8 0.1768 78 101 0 8 0.1768 54 70 0 8 0.1768 22 164 0 8 0.1768 98 165 0 8 0.1751 26 208 0 8 0.1751 26 101 0 8 0.1751 157 197 0 8 0.1734 112 210 0 8 0.1734 78 164 0 8 0.1734 78 102 0 8 0.1734 29 83 0 8 0.1734 25 173 0 8 0.1734 18 29 0 8 0.1734 38 72 0 8 0.1717 110 176 0 8 0.17 98 137 0 8 0.17 78 87 0 8 0.17 29 73 0 8 0.17 21 72 0 8 0.17 20 35 0 8 0.17 18 179 0 8 0.17 END