PFRMAT RR TARGET T0232 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artificial neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 MEDGMNTFDLYYWPVPFRGQLIRGILAHCGCSWDEHDVDAIEGLMDCGAE KQPVAFMGPPVLIDRERNFAISQMPAIAIYLGERLDILPATVEGRTLSAK IVNDANDVLDELTLNGGREMWTPEKWQEFVPRLQKWIRIFADTGARNGLS AASGFMLGTEKIGVADIVTAILWTTVADRFPAIKGIIEDTSPIIWGLSRR VVATAPLAALNSKSFEEYGNAYCGGEIEKSLRKVAS 16 73 0 8 0.392 21 73 0 8 0.37 17 197 0 8 0.337 16 197 0 8 0.31 24 173 0 8 0.3 22 167 0 8 0.298 10 170 0 8 0.293 21 197 0 8 0.288 22 62 0 8 0.283 29 73 0 8 0.28 16 169 0 8 0.278 21 74 0 8 0.276 92 169 0 8 0.271 22 74 0 8 0.261 166 199 0 8 0.259 51 73 0 8 0.259 48 169 0 8 0.259 17 82 0 8 0.257 5 77 0 8 0.257 76 167 0 8 0.25 24 201 0 8 0.25 21 174 0 8 0.248 112 165 0 8 0.246 73 136 0 8 0.246 35 73 0 8 0.246 73 197 0 8 0.243 140 167 0 8 0.241 55 73 0 8 0.241 96 169 0 8 0.239 73 169 0 8 0.239 28 167 0 8 0.239 173 197 0 8 0.237 22 73 0 8 0.237 59 73 0 8 0.235 19 61 0 8 0.235 18 29 0 8 0.235 76 157 0 8 0.232 10 171 0 8 0.232 17 73 0 8 0.23 79 99 0 8 0.228 72 168 0 8 0.228 22 169 0 8 0.228 22 164 0 8 0.228 25 167 0 8 0.226 26 73 0 8 0.224 162 198 0 8 0.222 76 96 0 8 0.222 29 206 0 8 0.222 19 86 0 8 0.222 138 165 0 8 0.22 38 61 0 8 0.22 19 197 0 8 0.22 12 73 0 8 0.22 162 197 0 8 0.218 153 171 0 8 0.218 106 174 0 8 0.218 25 170 0 8 0.218 23 165 0 8 0.218 13 174 0 8 0.218 71 95 0 8 0.216 28 204 0 8 0.216 25 136 0 8 0.216 22 197 0 8 0.216 19 102 0 8 0.216 18 74 0 8 0.216 171 197 0 8 0.214 164 174 0 8 0.214 114 197 0 8 0.214 75 163 0 8 0.214 12 197 0 8 0.214 144 197 0 8 0.212 141 192 0 8 0.212 89 98 0 8 0.212 87 174 0 8 0.212 78 168 0 8 0.212 73 102 0 8 0.212 59 197 0 8 0.212 17 26 0 8 0.212 168 200 0 8 0.21 157 172 0 8 0.21 156 168 0 8 0.21 79 170 0 8 0.21 74 164 0 8 0.21 28 165 0 8 0.21 24 62 0 8 0.21 23 62 0 8 0.21 21 115 0 8 0.21 21 48 0 8 0.21 134 167 0 8 0.208 32 167 0 8 0.208 18 171 0 8 0.208 162 200 0 8 0.206 78 170 0 8 0.206 74 114 0 8 0.206 72 102 0 8 0.206 61 157 0 8 0.206 26 64 0 8 0.206 22 157 0 8 0.206 21 62 0 8 0.206 19 62 0 8 0.206 12 165 0 8 0.206 11 73 0 8 0.206 167 201 0 8 0.204 157 168 0 8 0.204 22 170 0 8 0.204 22 98 0 8 0.204 22 78 0 8 0.204 17 169 0 8 0.204 17 62 0 8 0.204 12 172 0 8 0.204 11 197 0 8 0.204 168 194 0 8 0.202 140 173 0 8 0.202 140 168 0 8 0.202 120 167 0 8 0.202 33 166 0 8 0.202 21 169 0 8 0.202 15 164 0 8 0.202 END