PFRMAT RR TARGET T0230 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length REMARK or to a limited set of high scoring pairs. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MPMSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMT MTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELRE KFGV 35 50 0 8 0.69615 89 99 0 8 0.6817 50 87 0 8 0.6222 26 52 0 8 0.6035 87 102 0 8 0.5967 89 98 0 8 0.59075 51 83 0 8 0.5814 35 49 0 8 0.54995 89 102 0 8 0.5338 53 85 0 8 0.5287 35 93 0 8 0.4998 33 52 0 8 0.4998 34 83 0 8 0.49725 25 52 0 8 0.4845 26 59 0 8 0.4794 25 53 0 8 0.4794 33 59 0 8 0.4743 50 85 0 8 0.46665 49 85 0 8 0.46665 50 84 0 8 0.46155 45 76 0 8 0.4488 33 53 0 8 0.4488 54 85 0 8 0.43945 33 85 0 8 0.43945 47 66 0 8 0.4369 34 59 0 8 0.43435 33 49 0 8 0.43435 33 84 0 8 0.4318 36 50 0 8 0.4267 33 83 0 8 0.4267 33 89 0 8 0.42075 33 58 0 8 0.4182 26 89 0 8 0.4182 50 89 0 8 0.41055 34 53 0 8 0.40885 52 87 0 8 0.4063 88 99 0 8 0.4012 35 59 0 8 0.39355 51 86 0 8 0.37825 33 88 0 8 0.37315 51 85 0 8 0.3706 33 51 0 8 0.3553 54 101 0 8 0.34765 35 85 0 8 0.34765 37 73 0 8 0.3383 26 50 0 8 0.3383 50 88 0 8 0.33575 25 55 0 8 0.3332 20 53 0 8 0.3332 27 103 0 8 0.3162 25 54 0 8 0.3162 37 76 0 8 0.31195 50 59 0 8 0.3094 20 33 0 8 0.3094 27 51 0 8 0.3026 19 34 0 8 0.30005 13 54 0 8 0.2975 53 86 0 8 0.2907 35 84 0 8 0.2907 24 33 0 8 0.2907 91 102 0 8 0.28815 19 33 0 8 0.28645 53 101 0 8 0.2839 28 49 0 8 0.2839 19 62 0 8 0.28135 52 89 0 8 0.2771 26 102 0 8 0.2771 33 50 0 8 0.27285 33 91 0 8 0.2686 59 93 0 8 0.26605 33 98 0 8 0.255 12 76 0 8 0.2533 59 85 0 8 0.25075 51 70 0 8 0.25075 33 94 0 8 0.2465 33 62 0 8 0.2465 16 70 0 8 0.2465 13 53 0 8 0.2448 53 84 0 8 0.24225 33 54 0 8 0.24225 89 103 0 8 0.24055 50 102 0 8 0.24055 25 89 0 8 0.24055 30 50 0 8 0.2346 27 58 0 8 0.23205 24 58 0 8 0.23205 33 86 0 8 0.23035 50 93 0 8 0.2278 25 58 0 8 0.2278 33 93 0 8 0.22185 20 35 0 8 0.21845 27 53 0 8 0.2142 58 85 0 8 0.2125 35 58 0 8 0.2125 25 59 0 8 0.2108 59 98 0 8 0.2091 35 53 0 8 0.20655 26 55 0 8 0.20315 24 53 0 8 0.20145 49 84 0 8 0.19975 27 54 0 8 0.19975 54 93 0 8 0.1972 59 91 0 8 0.1938 50 94 0 8 0.1938 27 52 0 8 0.1938 19 37 0 8 0.1938 13 39 0 8 0.1921 27 93 0 8 0.1904 50 98 0 8 0.1887 89 100 0 8 0.1853 29 53 0 8 0.1836 49 98 0 8 0.1768 49 73 0 8 0.1768 35 87 0 8 0.1768 13 29 0 8 0.1768 66 102 0 8 0.1751 26 98 0 8 0.1734 END