CASP6 Target T0224
-
1. Protein Name
- TM0979
-
2. Organism Name
- Thermotoga maritima
-
3. Number of amino acids (approx)
- 87
-
4. Accession number
- AAD36058
-
5. Sequence Database
- Genbank
-
6. Amino acid sequence
-
MALVLVKYGTDHPVEKLKIRSAKAEDKIVLIQNGVFWALEELETPAKVYAIKDDFLARGY
SEEDSKVPLITYSEFIDLLEGEEKFIG
-
7. Additional information
-
JCSG target TM0979
-
8. X-ray structure
- no
-
9. Current state of the experimental work
- structure solved, deposited in PDB, on hold
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- done
-
12. Estimated date of public release of structure
- after September 1
Related Files
Template Sequence file
Template PDB file