PFRMAT RR
TARGET T0224
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The predictions are limited to a score >= .18 which
REMARK is an approximation of the probability.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 280 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD NN: /projects/compbio/experiments/protein-predict/casp6/networks/NN280-240n300.net.28
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
MALVLVKYGTDHPVEKLKIRSAKAEDKIVLIQNGVFWALEELETPAKVYA
IKDDFLARGYSEEDSKVPLITYSEFIDLLEGEEKFIG
5 72 0 8 0.47175
22 75 0 8 0.3859
3 60 0 8 0.36295
34 51 0 8 0.35275
32 70 0 8 0.34085
51 70 0 8 0.3332
60 79 0 8 0.30005
4 79 0 8 0.29495
4 60 0 8 0.29495
51 60 0 8 0.27455
2 60 0 8 0.27455
3 71 0 8 0.2703
12 86 0 8 0.255
3 29 0 8 0.238
55 67 0 8 0.2261
6 69 0 8 0.21845
17 34 0 8 0.2108
2 29 0 8 0.2091
2 71 0 8 0.1955
46 70 0 8 0.1853
51 79 0 8 0.1819
7 69 0 8 0.1802
2 51 0 8 0.1802
END