PFRMAT RR
TARGET T0224
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximate of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artifical neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MALVLVKYGTDHPVEKLKIRSAKAEDKIVLIQNGVFWALEELETPAKVYA
IKDDFLARGYSEEDSKVPLITYSEFIDLLEGEEKFIG
3 71 0 8 0.293
32 70 0 8 0.278
31 48 0 8 0.259
22 75 0 8 0.259
34 51 0 8 0.257
37 66 0 8 0.25
34 52 0 8 0.248
3 37 0 8 0.246
5 72 0 8 0.243
32 78 0 8 0.241
4 79 0 8 0.241
31 52 0 8 0.237
2 51 0 8 0.237
51 70 0 8 0.235
33 51 0 8 0.226
3 29 0 8 0.22
32 85 0 8 0.216
32 46 0 8 0.212
3 82 0 8 0.212
17 34 0 8 0.21
6 69 0 8 0.21
31 46 0 8 0.208
2 29 0 8 0.206
38 48 0 8 0.204
51 76 0 8 0.202
51 60 0 8 0.202
19 33 0 8 0.202
3 25 0 8 0.2
4 51 0 8 0.196
29 71 0 8 0.194
2 82 0 8 0.194
32 74 0 8 0.192
3 66 0 8 0.192
51 79 0 8 0.189
34 80 0 8 0.189
29 74 0 8 0.189
7 66 0 8 0.189
28 66 0 8 0.187
9 25 0 8 0.183
4 19 0 8 0.183
38 65 0 8 0.18
3 55 0 8 0.18
2 79 0 8 0.18
END