PFRMAT RR
TARGET T0223
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The predictions are limited to a score >= .18 which
REMARK is an approximation of the probability.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 280 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD NN: NN280-240n300.net.28
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
MNIFEAIENRHSVRDFLERKMPERVKDDIENLLVKFITKKLDWKINLSSF
PSYIYAKAEKHFDELVEYGFQGEQIVLFLTAQGFGTCWMARSPHPDVPYI
IVFGYPRTRNFTRKRRPITSFLENDLEELPPEIVKIVEMTILAPSALNRQ
PWKIKYTGGELCISSERPVDLGIALSHAYLTAREIFKREPVIQKRGEDTY
CLILNP
76 86 0 8 0.52615
25 105 0 8 0.50915
88 99 0 8 0.41565
39 116 0 8 0.3553
79 103 0 8 0.33575
75 100 0 8 0.3332
41 156 0 8 0.32385
56 103 0 8 0.3162
56 88 0 8 0.3026
68 99 0 8 0.30005
10 88 0 8 0.28815
76 171 0 8 0.28135
76 156 0 8 0.255
52 103 0 8 0.255
74 152 0 8 0.25075
77 88 0 8 0.24225
126 162 0 8 0.23205
58 133 0 8 0.23205
43 161 0 8 0.23205
10 56 0 8 0.23205
70 100 0 8 0.23035
138 152 0 8 0.2261
58 99 0 8 0.2244
10 99 0 8 0.2244
56 152 0 8 0.21845
68 102 0 8 0.21675
56 70 0 8 0.21675
52 71 0 8 0.2125
10 100 0 8 0.2125
43 70 0 8 0.2091
141 161 0 8 0.20655
43 141 0 8 0.20655
74 103 0 8 0.20485
46 99 0 8 0.20485
45 99 0 8 0.20485
10 80 0 8 0.20315
116 147 0 8 0.1972
46 58 0 8 0.1972
55 82 0 8 0.1955
66 76 0 8 0.1938
127 162 0 8 0.1921
97 178 0 8 0.187
126 152 0 8 0.1836
34 129 0 8 0.1802
END