PFRMAT RR
TARGET T0223
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximate of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artifical neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MNIFEAIENRHSVRDFLERKMPERVKDDIENLLVKFITKKLDWKINLSSF
PSYIYAKAEKHFDELVEYGFQGEQIVLFLTAQGFGTCWMARSPHPDVPYI
IVFGYPRTRNFTRKRRPITSFLENDLEELPPEIVKIVEMTILAPSALNRQ
PWKIKYTGGELCISSERPVDLGIALSHAYLTAREIFKREPVIQKRGEDTY
CLILNP
46 99 0 8 0.337
68 99 0 8 0.326
76 86 0 8 0.318
52 71 0 8 0.313
70 100 0 8 0.303
79 103 0 8 0.285
74 103 0 8 0.285
70 138 0 8 0.28
75 100 0 8 0.278
88 99 0 8 0.271
68 102 0 8 0.271
76 171 0 8 0.266
101 141 0 8 0.261
101 134 0 8 0.259
95 168 0 8 0.259
56 70 0 8 0.257
55 103 0 8 0.257
52 103 0 8 0.257
37 71 0 8 0.257
56 103 0 8 0.255
43 70 0 8 0.252
28 100 0 8 0.252
55 68 0 8 0.25
49 102 0 8 0.239
76 156 0 8 0.235
78 98 0 8 0.232
56 74 0 8 0.23
103 142 0 8 0.228
71 136 0 8 0.228
100 162 0 8 0.226
40 100 0 8 0.226
78 176 0 8 0.224
58 99 0 8 0.224
76 92 0 8 0.222
69 170 0 8 0.222
65 99 0 8 0.222
54 66 0 8 0.222
70 80 0 8 0.216
67 101 0 8 0.216
45 162 0 8 0.216
31 98 0 8 0.216
4 113 0 8 0.216
76 182 0 8 0.214
3 98 0 8 0.214
51 74 0 8 0.212
10 100 0 8 0.212
74 138 0 8 0.21
25 105 0 8 0.21
10 99 0 8 0.21
136 176 0 8 0.208
99 116 0 8 0.208
77 88 0 8 0.208
11 98 0 8 0.208
8 102 0 8 0.208
173 182 0 8 0.206
136 183 0 8 0.206
98 133 0 8 0.206
76 135 0 8 0.206
53 86 0 8 0.206
33 175 0 8 0.204
73 182 0 8 0.202
10 88 0 8 0.202
86 182 0 8 0.2
71 183 0 8 0.2
156 174 0 8 0.198
102 155 0 8 0.198
75 92 0 8 0.198
70 142 0 8 0.198
69 145 0 8 0.198
55 82 0 8 0.198
31 76 0 8 0.198
6 174 0 8 0.198
126 162 0 8 0.196
56 179 0 8 0.196
56 88 0 8 0.196
46 94 0 8 0.196
37 100 0 8 0.196
33 70 0 8 0.196
176 193 0 8 0.194
135 171 0 8 0.194
100 114 0 8 0.194
75 162 0 8 0.194
71 181 0 8 0.194
126 138 0 8 0.192
33 74 0 8 0.192
71 94 0 8 0.191
70 114 0 8 0.191
62 101 0 8 0.191
39 100 0 8 0.191
22 100 0 8 0.191
93 147 0 8 0.189
71 95 0 8 0.189
142 162 0 8 0.187
102 122 0 8 0.187
82 101 0 8 0.187
74 142 0 8 0.187
71 185 0 8 0.187
41 156 0 8 0.187
107 141 0 8 0.185
103 168 0 8 0.185
101 124 0 8 0.185
97 178 0 8 0.185
74 152 0 8 0.185
END