PFRMAT RR TARGET T0222 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artificial neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 MAAFQIANKTVGKDAPVFIIAEAGINHDGKLDQAFALIDAAAEAGADAVK FQMFQADRMYQKDPGLYKTAAGKDVSIFSLVQSMEMPAEWILPLLDYCRE KQVIFLSTVCDEGSADLLQSTSPSAFKIASYEINHLPLLKYVARLNRPMI FSTAGAEISDVHEAWRTIRAEGNNQIAIMHCVAKYPAPPEYSNLSVIPML AAAFPEAVIGFSDHSEHPTEAPCAAVRLGAKLIEKHFTIDKNLPGADHSF ALNPDELKEMVDGIRKTEAELKQGITKPVSEKLLGSSYKTTTAIEGEIRN FAYRGIFTTAPIQKGEAFSEDNIAVLRPGQKPQGLHPRFFELLTSGVRAV RDIPADTGIVWDDILLKDSPFHE 130 210 0 8 0.442 130 230 0 8 0.404 180 210 0 8 0.401 130 181 0 8 0.384 130 180 0 8 0.381 211 230 0 8 0.378 181 210 0 8 0.367 38 210 0 8 0.364 108 210 0 8 0.347 41 130 0 8 0.347 127 210 0 8 0.342 38 130 0 8 0.339 37 235 0 8 0.337 25 53 0 8 0.334 108 130 0 8 0.329 27 210 0 8 0.326 27 130 0 8 0.323 27 132 0 8 0.316 34 252 0 8 0.313 180 230 0 8 0.31 139 212 0 8 0.31 27 108 0 8 0.31 27 38 0 8 0.308 108 127 0 8 0.305 152 181 0 8 0.3 150 180 0 8 0.298 84 250 0 8 0.295 222 260 0 8 0.293 210 230 0 8 0.293 230 264 0 8 0.29 181 230 0 8 0.29 152 180 0 8 0.29 132 181 0 8 0.29 108 193 0 8 0.29 25 250 0 8 0.29 25 84 0 8 0.29 127 180 0 8 0.288 177 232 0 8 0.283 152 210 0 8 0.283 51 196 0 8 0.283 98 181 0 8 0.28 25 106 0 8 0.28 179 230 0 8 0.278 41 181 0 8 0.278 40 188 0 8 0.278 29 210 0 8 0.278 25 77 0 8 0.278 24 135 0 8 0.278 27 180 0 8 0.276 25 107 0 8 0.276 130 152 0 8 0.273 108 181 0 8 0.273 108 180 0 8 0.273 126 230 0 8 0.271 53 107 0 8 0.271 25 81 0 8 0.271 153 230 0 8 0.266 81 211 0 8 0.266 25 54 0 8 0.266 22 177 0 8 0.266 19 212 0 8 0.264 21 139 0 8 0.261 130 153 0 8 0.259 179 210 0 8 0.257 139 225 0 8 0.257 41 230 0 8 0.257 25 67 0 8 0.257 23 135 0 8 0.257 212 232 0 8 0.255 72 84 0 8 0.255 24 126 0 8 0.255 24 84 0 8 0.255 20 38 0 8 0.255 18 126 0 8 0.255 48 177 0 8 0.252 25 108 0 8 0.252 179 211 0 8 0.25 179 193 0 8 0.25 77 302 0 8 0.25 27 152 0 8 0.25 23 207 0 8 0.25 211 226 0 8 0.248 142 335 0 8 0.248 90 250 0 8 0.248 27 181 0 8 0.248 27 41 0 8 0.248 25 230 0 8 0.248 211 250 0 8 0.246 211 221 0 8 0.246 210 232 0 8 0.246 131 192 0 8 0.246 126 180 0 8 0.246 51 139 0 8 0.246 25 180 0 8 0.246 19 135 0 8 0.246 180 211 0 8 0.243 108 152 0 8 0.243 51 211 0 8 0.243 41 50 0 8 0.243 25 126 0 8 0.243 24 211 0 8 0.243 208 324 0 8 0.241 132 180 0 8 0.241 51 261 0 8 0.241 25 210 0 8 0.241 106 135 0 8 0.239 81 250 0 8 0.239 54 81 0 8 0.239 37 180 0 8 0.239 25 131 0 8 0.239 126 210 0 8 0.237 25 37 0 8 0.237 211 228 0 8 0.235 126 211 0 8 0.235 108 230 0 8 0.235 54 77 0 8 0.235 41 179 0 8 0.235 41 126 0 8 0.235 37 209 0 8 0.235 27 230 0 8 0.235 26 230 0 8 0.235 25 193 0 8 0.235 25 125 0 8 0.235 25 90 0 8 0.235 25 50 0 8 0.235 107 180 0 8 0.232 51 84 0 8 0.232 38 230 0 8 0.232 29 180 0 8 0.232 25 211 0 8 0.232 25 72 0 8 0.232 127 230 0 8 0.23 80 211 0 8 0.23 53 110 0 8 0.23 41 180 0 8 0.23 38 108 0 8 0.23 26 126 0 8 0.23 25 80 0 8 0.23 25 66 0 8 0.23 25 55 0 8 0.23 18 115 0 8 0.23 18 112 0 8 0.23 18 111 0 8 0.23 307 326 0 8 0.228 208 336 0 8 0.228 142 339 0 8 0.228 130 179 0 8 0.228 129 210 0 8 0.228 112 231 0 8 0.228 53 106 0 8 0.228 41 210 0 8 0.228 37 211 0 8 0.228 27 114 0 8 0.228 26 180 0 8 0.228 24 129 0 8 0.228 24 77 0 8 0.228 131 250 0 8 0.226 127 139 0 8 0.226 91 107 0 8 0.226 77 250 0 8 0.226 67 84 0 8 0.226 53 71 0 8 0.226 41 231 0 8 0.226 41 127 0 8 0.226 29 130 0 8 0.226 26 210 0 8 0.226 26 179 0 8 0.226 153 210 0 8 0.224 139 181 0 8 0.224 126 181 0 8 0.224 125 211 0 8 0.224 108 232 0 8 0.224 80 107 0 8 0.224 71 84 0 8 0.224 53 77 0 8 0.224 49 133 0 8 0.224 25 135 0 8 0.224 25 130 0 8 0.224 24 131 0 8 0.224 24 55 0 8 0.224 20 205 0 8 0.224 181 211 0 8 0.222 130 211 0 8 0.222 108 179 0 8 0.222 107 210 0 8 0.222 107 118 0 8 0.222 END