PFRMAT RR TARGET T0222 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: /projects/compbio/experiments/protein-predict/casp6/networks/NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 HFTIDKNLPGADHSFALNPDELKEMVDGIRKTEAELKQGITKPVSEKLLG SSYKTTTAIEGEIRNFAYRGIFTTAPIQKGEAFSEDNIAVLRPGQKPQGL HPRFFELLTSGVRAVRDIPADTGIVWDDILLKDSPFHE 267 298 0 8 0.4896 307 326 0 8 0.4063 248 309 0 8 0.3961 267 307 0 8 0.2703 250 326 0 8 0.2363 294 303 0 8 0.2346 250 307 0 8 0.2261 248 307 0 8 0.20485 248 324 0 8 0.20145 309 358 0 8 0.1938 267 326 0 8 0.187 END