PFRMAT RR
TARGET T0221
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MKTIQPCSVEDIQSWLIDQFAQQLDVDPDDIDMEESFDNYDLNSSKALIL
LGRLEKWLGKELNPVLIFNYPTIAQLAKRLGELYL
20 42 0 8 0.671
13 42 0 8 0.628
42 64 0 8 0.616
32 42 0 8 0.616
19 42 0 8 0.579
20 35 0 8 0.555
42 52 0 8 0.552
20 43 0 8 0.552
42 51 0 8 0.543
20 38 0 8 0.525
42 55 0 8 0.508
15 42 0 8 0.498
20 36 0 8 0.492
42 66 0 8 0.489
20 64 0 8 0.489
10 42 0 8 0.478
32 64 0 8 0.46
42 58 0 8 0.457
20 46 0 8 0.448
20 73 0 8 0.445
42 73 0 8 0.436
16 73 0 8 0.427
52 64 0 8 0.412
42 65 0 8 0.412
15 57 0 8 0.412
16 54 0 8 0.409
16 51 0 8 0.409
13 38 0 8 0.407
20 51 0 8 0.404
26 42 0 8 0.384
19 49 0 8 0.37
13 46 0 8 0.37
20 52 0 8 0.367
13 73 0 8 0.367
20 40 0 8 0.356
51 64 0 8 0.353
36 51 0 8 0.353
19 50 0 8 0.353
20 32 0 8 0.347
55 64 0 8 0.342
36 64 0 8 0.342
47 64 0 8 0.339
END