PFRMAT RR TARGET T0220 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximate of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artifical neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 METLILTQEEVESLISMDEAMNAVEEAFRLYALGKAQMPPKVYLEFEKGD LRAMPAHLMGYAGLKWVNSHPGNPDKGLPTVMALMILNSPETGFPLAVMD ATYTTSLRTGAAGGIAAKYLARKNSSVFGFIGCGTQAYFQLEALRRVFDI GEVKAYDVREKAAKKFVSYCEDRGISASVQPAEEASRCDVLVTTTPSRKP VVKAEWVEEGTHINAIGADGPGKQELDVEILKKAKIVVDDLEQAKHGGEI NVAVSKGVIGVEDVHATIGEVIAGLKDGRESDEEITIFDSTGLAIQDVAV AKVVYENALSKNVGSKIKFFRI 219 243 0 8 0.451 140 214 0 8 0.445 215 225 0 8 0.436 143 217 0 8 0.427 194 217 0 8 0.421 225 249 0 8 0.412 121 143 0 8 0.412 56 140 0 8 0.409 41 54 0 8 0.404 108 140 0 8 0.401 80 105 0 8 0.401 136 217 0 8 0.398 54 67 0 8 0.398 105 136 0 8 0.392 87 108 0 8 0.392 83 105 0 8 0.392 218 242 0 8 0.389 200 218 0 8 0.389 109 212 0 8 0.389 109 121 0 8 0.386 105 216 0 8 0.386 105 225 0 8 0.384 83 108 0 8 0.381 109 230 0 8 0.378 39 54 0 8 0.375 136 200 0 8 0.372 109 136 0 8 0.372 87 109 0 8 0.372 54 136 0 8 0.372 140 223 0 8 0.37 140 215 0 8 0.364 54 214 0 8 0.364 54 109 0 8 0.364 39 57 0 8 0.364 136 215 0 8 0.361 133 157 0 8 0.361 137 217 0 8 0.358 136 214 0 8 0.358 218 238 0 8 0.356 108 136 0 8 0.356 87 215 0 8 0.356 39 222 0 8 0.356 39 56 0 8 0.356 193 238 0 8 0.353 140 230 0 8 0.353 54 97 0 8 0.353 193 215 0 8 0.35 148 248 0 8 0.35 109 244 0 8 0.35 56 109 0 8 0.345 108 269 0 8 0.342 105 140 0 8 0.342 193 217 0 8 0.339 108 212 0 8 0.339 54 108 0 8 0.339 41 140 0 8 0.339 137 214 0 8 0.337 120 211 0 8 0.337 140 212 0 8 0.334 129 215 0 8 0.334 108 191 0 8 0.334 227 248 0 8 0.331 66 88 0 8 0.331 56 217 0 8 0.331 56 136 0 8 0.331 223 243 0 8 0.329 144 192 0 8 0.329 97 108 0 8 0.326 223 248 0 8 0.323 215 244 0 8 0.323 129 139 0 8 0.323 108 268 0 8 0.323 104 140 0 8 0.323 39 60 0 8 0.323 136 150 0 8 0.321 89 268 0 8 0.321 89 136 0 8 0.321 87 122 0 8 0.321 39 49 0 8 0.321 73 92 0 8 0.318 219 248 0 8 0.316 121 268 0 8 0.316 115 194 0 8 0.316 101 269 0 8 0.316 56 268 0 8 0.316 218 243 0 8 0.313 200 239 0 8 0.313 140 272 0 8 0.313 139 193 0 8 0.313 120 213 0 8 0.313 215 238 0 8 0.31 129 140 0 8 0.31 109 268 0 8 0.31 87 140 0 8 0.31 54 86 0 8 0.31 227 238 0 8 0.308 136 269 0 8 0.308 120 212 0 8 0.308 108 248 0 8 0.308 89 108 0 8 0.308 140 243 0 8 0.305 129 188 0 8 0.305 55 67 0 8 0.305 39 82 0 8 0.305 129 157 0 8 0.303 125 150 0 8 0.303 121 212 0 8 0.303 87 143 0 8 0.303 212 286 0 8 0.3 143 248 0 8 0.3 140 216 0 8 0.3 137 239 0 8 0.3 136 268 0 8 0.3 67 222 0 8 0.3 212 269 0 8 0.298 129 271 0 8 0.298 113 140 0 8 0.298 105 215 0 8 0.298 56 200 0 8 0.298 54 222 0 8 0.298 218 227 0 8 0.295 110 237 0 8 0.295 108 217 0 8 0.295 105 248 0 8 0.295 105 214 0 8 0.295 136 213 0 8 0.293 129 156 0 8 0.293 111 268 0 8 0.293 108 137 0 8 0.293 28 39 0 8 0.293 226 245 0 8 0.29 85 140 0 8 0.29 143 212 0 8 0.288 129 184 0 8 0.288 117 212 0 8 0.288 111 200 0 8 0.285 105 212 0 8 0.285 101 136 0 8 0.285 52 219 0 8 0.285 41 217 0 8 0.285 41 67 0 8 0.285 212 225 0 8 0.283 201 225 0 8 0.283 200 238 0 8 0.283 192 214 0 8 0.283 140 217 0 8 0.283 122 268 0 8 0.283 109 200 0 8 0.283 86 214 0 8 0.283 84 140 0 8 0.283 54 140 0 8 0.283 43 82 0 8 0.283 125 148 0 8 0.28 121 274 0 8 0.28 120 136 0 8 0.28 3 39 0 8 0.28 143 227 0 8 0.278 136 212 0 8 0.278 109 271 0 8 0.278 108 271 0 8 0.278 54 216 0 8 0.278 END