PFRMAT RR
TARGET T0214
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximate of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artifical neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVR
VKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGV
VAIEIEPLEY
49 93 0 8 0.232
35 98 0 8 0.226
2 56 0 8 0.204
25 38 0 8 0.196
43 91 0 8 0.192
69 107 0 8 0.191
8 105 0 8 0.187
3 55 0 8 0.185
27 36 0 8 0.183
84 107 0 8 0.181
2 55 0 8 0.181
59 75 0 8 0.18
36 105 0 8 0.18
62 75 0 8 0.178
33 48 0 8 0.178
50 88 0 8 0.176
77 87 0 8 0.174
39 109 0 8 0.174
33 55 0 8 0.174
83 92 0 8 0.171
50 85 0 8 0.171
46 75 0 8 0.171
36 55 0 8 0.171
53 77 0 8 0.166
44 56 0 8 0.166
17 77 0 8 0.166
59 101 0 8 0.164
44 53 0 8 0.164
27 105 0 8 0.164
27 49 0 8 0.164
10 98 0 8 0.164
36 61 0 8 0.163
33 49 0 8 0.163
29 105 0 8 0.163
13 48 0 8 0.163
64 74 0 8 0.161
17 53 0 8 0.161
9 73 0 8 0.161
2 104 0 8 0.161
75 101 0 8 0.159
65 105 0 8 0.159
13 55 0 8 0.159
76 105 0 8 0.158
61 98 0 8 0.158
47 80 0 8 0.158
39 51 0 8 0.158
36 66 0 8 0.158
34 45 0 8 0.158
35 74 0 8 0.156
33 52 0 8 0.156
31 45 0 8 0.156
17 74 0 8 0.156
9 102 0 8 0.156
91 101 0 8 0.155
58 79 0 8 0.155
END