CASP6 Target T0212
-
1. Protein Name
- SOR45
-
2. Organism Name
- S. oneidensis
-
3. Number of amino acids (approx)
- 126
-
4. Accession number
-
5. Sequence Database
-
6. Amino acid sequence
-
MSALDNSIRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRHWIITDANGKT
SEVQGAGVVGETPTIPPNTAYQYTSGTVLDTPFGIMYGTYGMVSESGEHFNAIIKPFRLA
TPGLLH
-
7. Additional information
-
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
-
12. Estimated date of public release of structure
- 8/1/2004
Related Files
Template Sequence file
Template PDB file